| UniProt ID | HSP31_YEAST | |
|---|---|---|
| UniProt AC | Q04432 | |
| Protein Name | Glutathione-independent glyoxalase HSP31 {ECO:0000303|PubMed:24302734} | |
| Gene Name | HSP31 {ECO:0000303|PubMed:14745011} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 237 | |
| Subcellular Localization | Cytoplasm, P-body . Present in processing bodies (P-bodies) and stress granule (SG) foci upon glucose starvation and heat shock. | |
| Protein Description | Catalyzes the conversion of methylglyoxal (MG) to D-lactate in a single glutathione (GSH)-independent step. May play a role in detoxifying endogenously produced glyoxals. [PubMed: 24302734 Involved in protection against reactive oxygen species (ROS)] | |
| Protein Sequence | MAPKKVLLALTSYNDVFYSDGAKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFFASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVCHGPAIFDGLTDKKTGRPLIEGKSITGFTDVGETILGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Acetylation | GQDETDFKNKDSDFN CCCCCCCCCCCCCHH | 66.93 | 24489116 | |
| 77 | Acetylation | DETDFKNKDSDFNKT CCCCCCCCCCCHHHH | 60.23 | 24489116 | |
| 138 | Oxidation | GGVVAAVCHGPAIFD CCEEEEEEECCHHHC | 2.35 | 14745011 | |
| 197 | Acetylation | VAKKYGAKYLAPVGP HHHHHCCEEEECCCC | 36.11 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSP31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSP31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSP31_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...