UniProt ID | YGY5_YEAST | |
---|---|---|
UniProt AC | P53071 | |
Protein Name | Uncharacterized protein YGL235W | |
Gene Name | YGL235W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 178 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTLWPHPGSYKIKSATLFCSRDKLGCAFLSESSLCMYFLYNSLSIWALGPHTAGPLLLFSILNCTPARSVTLPISPSRASISFTRMPLPTPPIEGLHEHLPISVNDGVMRVVCAPVLDDAAAASQPACPAPMTTTCVLVVGWKLVKEDMVNRLLRTCKGNEVHEDAKVVTRSIVLWGV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | TLWPHPGSYKIKSAT CCCCCCCCCEEEEEE | 27.92 | 28889911 | |
10 | Phosphorylation | LWPHPGSYKIKSATL CCCCCCCCEEEEEEE | 23.73 | 28889911 | |
14 | Phosphorylation | PGSYKIKSATLFCSR CCCCEEEEEEEEECC | 29.93 | 28889911 | |
16 | Phosphorylation | SYKIKSATLFCSRDK CCEEEEEEEEECCCC | 27.71 | 28889911 | |
84 | Phosphorylation | SRASISFTRMPLPTP CCCEEEEEECCCCCC | 21.19 | 19779198 | |
90 | Phosphorylation | FTRMPLPTPPIEGLH EEECCCCCCCCCCHH | 49.75 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGY5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGY5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGY5_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...