| UniProt ID | CLD1_YEAST | |
|---|---|---|
| UniProt AC | P53264 | |
| Protein Name | Cardiolipin-specific deacylase 1, mitochondrial | |
| Gene Name | CLD1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 445 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Mitochondrial cardiolipin-specific phospholipase which deacylates de novo synthesized cardiolipin. Part of the remodeling process of cardiolipin, which involves deacylation-reacylation of premature cardiolipin. Has a strong substrate preference for palmitic acid residues and generates monolysocardiolipin for TAZ1-dependent reacylation with unsaturated fatty acids.. | |
| Protein Sequence | MFKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | Phosphorylation | QLLRGADSSNTRPQS HHHCCCCCCCCCCCC | 25.59 | 24930733 | |
| 26 | Phosphorylation | LLRGADSSNTRPQSP HHCCCCCCCCCCCCC | 42.65 | 24930733 | |
| 32 | Phosphorylation | SSNTRPQSPRASARD CCCCCCCCCCCCCCC | 21.02 | 23607784 | |
| 36 | Phosphorylation | RPQSPRASARDVTEK CCCCCCCCCCCCCHH | 25.72 | 23607784 | |
| 100 | Phosphorylation | LLKTLPFYPTPSESK HHHHCCCCCCCCCCH | 12.31 | 25882841 | |
| 108 | Phosphorylation | PTPSESKTARLIRTV CCCCCCHHHEEEEEE | 26.70 | 25882841 | |
| 230 | Phosphorylation | KNIVMAHSLGSYLMA CCEEEHHHHHHHHHH | 25.53 | 27017623 | |
| 233 | Phosphorylation | VMAHSLGSYLMALYL EEHHHHHHHHHHHHH | 22.01 | 27017623 | |
| 234 | Phosphorylation | MAHSLGSYLMALYLQ EHHHHHHHHHHHHHH | 9.94 | 27017623 | |
| 239 | Phosphorylation | GSYLMALYLQKYKES HHHHHHHHHHHHCCC | 9.50 | 27017623 | |
| 243 | Phosphorylation | MALYLQKYKESPSFK HHHHHHHHCCCCCCC | 13.66 | 27017623 | |
| 246 | Phosphorylation | YLQKYKESPSFKKLI HHHHHCCCCCCCEEE | 22.99 | 24930733 | |
| 248 | Phosphorylation | QKYKESPSFKKLILC HHHCCCCCCCEEEEE | 60.00 | 24930733 | |
| 270 | Phosphorylation | RDFNNTASEVEKWKP HHCCCCHHHHHHCCC | 39.89 | 24930733 | |
| 307 | Phosphorylation | RQLGSKITSGWSYRR HHHCCCCCCCCHHHH | 25.56 | 27017623 | |
| 311 | Phosphorylation | SKITSGWSYRRFKHI CCCCCCCHHHHHHHH | 16.58 | 27017623 | |
| 312 | Phosphorylation | KITSGWSYRRFKHIL CCCCCCHHHHHHHHH | 10.17 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLD1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLD1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CLD1_YEAST !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
