UniProt ID | HUT1_YEAST | |
---|---|---|
UniProt AC | Q12520 | |
Protein Name | UDP-galactose transporter homolog 1 | |
Gene Name | HUT1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 339 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in specific transport of UDP-Gal from the cytosol to the Golgi lumen. Involved in the maintenance of optimal conditions for the folding of secretory pathway proteins in the endoplasmic reticulum. Overexpression confers resistance to the immunosuppressive drug, leflunomide.. | |
Protein Sequence | MAGSTSSLVICAIGIYATFLTWALVQEPLATRTWPNSMGKFQFPNVISLIQASVAMMMGYLYLNWKKVEYPPRKMIKDHWKQLMLISFTQSSSGPLATTSLKHVDYLTYMLAKSCKMIPVLLVHLLLYRTPIASQKKVVALLVSLGVTIFTIGGNDGKKLKRSFNESGNDNKLQGFGLLFSSLFLDGLTNATQDKLLKANKAKEKGKQTLITGAHLMFTLNLFVILWNILYFIVIDCKQWDNAVSVLTMDPQVWGYLMLYSFCGAMGQCFIFYTLEQFGSLVLIMITVTRKMVSMILSIIVFGKSVRFQQWVGMFIVFGGITWEALNKKKANIPKAKSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
165 | N-linked_Glycosylation | KKLKRSFNESGNDNK HHHHHHHCCCCCCCC | 43.71 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HUT1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HUT1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HUT1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...