UniProt ID | RS6A_YEAST | |
---|---|---|
UniProt AC | P0CX37 | |
Protein Name | 40S ribosomal protein S6-A {ECO:0000303|PubMed:9559554} | |
Gene Name | RPS6A {ECO:0000303|PubMed:9559554} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 236 | |
Subcellular Localization | Cytoplasm . Nucleus, nucleolus . | |
Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. [PubMed: 22096102 eS6 is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly] | |
Protein Sequence | MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Succinylation | ------MKLNISYPV ------CCCEEEEEC | 50.68 | 23954790 | |
2 | Ubiquitination | ------MKLNISYPV ------CCCEEEEEC | 50.68 | - | |
6 | Phosphorylation | --MKLNISYPVNGSQ --CCCEEEEECCCCE | 23.47 | 22369663 | |
7 | Phosphorylation | -MKLNISYPVNGSQK -CCCEEEEECCCCEE | 13.85 | 22369663 | |
12 | Phosphorylation | ISYPVNGSQKTFEID EEEECCCCEEEEEEC | 24.25 | 22369663 | |
14 | Acetylation | YPVNGSQKTFEIDDE EECCCCEEEEEECCH | 57.80 | 24489116 | |
14 | Ubiquitination | YPVNGSQKTFEIDDE EECCCCEEEEEECCH | 57.80 | - | |
46 | Ubiquitination | EAVGDEFKGYVFKIS EECCCCCCEEEEEEE | 47.48 | - | |
46 | Succinylation | EAVGDEFKGYVFKIS EECCCCCCEEEEEEE | 47.48 | 23954790 | |
46 | Acetylation | EAVGDEFKGYVFKIS EECCCCCCEEEEEEE | 47.48 | 24489116 | |
51 | Acetylation | EFKGYVFKISGGNDK CCCEEEEEEECCCCC | 26.39 | 24489116 | |
51 | Succinylation | EFKGYVFKISGGNDK CCCEEEEEEECCCCC | 26.39 | 23954790 | |
53 | Phosphorylation | KGYVFKISGGNDKQG CEEEEEEECCCCCCC | 41.04 | 21551504 | |
58 | Acetylation | KISGGNDKQGFPMKQ EEECCCCCCCCCCCC | 57.21 | 24489116 | |
58 | Ubiquitination | KISGGNDKQGFPMKQ EEECCCCCCCCCCCC | 57.21 | - | |
64 | Ubiquitination | DKQGFPMKQGVLLPT CCCCCCCCCCEECCC | 44.10 | - | |
74 | Acetylation | VLLPTRIKLLLTKNV EECCCHHHEEECCCC | 29.77 | 24489116 | |
79 | Acetylation | RIKLLLTKNVSCYRP HHHEEECCCCCCCCC | 56.15 | 24489116 | |
79 | Ubiquitination | RIKLLLTKNVSCYRP HHHEEECCCCCCCCC | 56.15 | - | |
82 | Phosphorylation | LLLTKNVSCYRPRRD EEECCCCCCCCCCCC | 18.15 | 28889911 | |
116 | Acetylation | LALVIVKKGEQELEG HEEEEEECCHHHHCC | 57.70 | 24489116 | |
116 | Ubiquitination | LALVIVKKGEQELEG HEEEEEECCHHHHCC | 57.70 | 22106047 | |
125 | Phosphorylation | EQELEGLTDTTVPKR HHHHCCCCCCCCCHH | 42.00 | 21440633 | |
127 | Phosphorylation | ELEGLTDTTVPKRLG HHCCCCCCCCCHHHC | 25.18 | 24961812 | |
128 | Phosphorylation | LEGLTDTTVPKRLGP HCCCCCCCCCHHHCH | 37.31 | 21440633 | |
131 | Acetylation | LTDTTVPKRLGPKRA CCCCCCCHHHCHHHH | 56.79 | 24489116 | |
131 | Succinylation | LTDTTVPKRLGPKRA CCCCCCCHHHCHHHH | 56.79 | 23954790 | |
131 | Ubiquitination | LTDTTVPKRLGPKRA CCCCCCCHHHCHHHH | 56.79 | 22106047 | |
143 | Ubiquitination | KRANNIRKFFGLSKE HHHHHHHHHHCCCCC | 41.05 | - | |
143 | Acetylation | KRANNIRKFFGLSKE HHHHHHHHHHCCCCC | 41.05 | 24489116 | |
148 | Phosphorylation | IRKFFGLSKEDDVRD HHHHHCCCCCCCCHH | 34.09 | 27214570 | |
149 | Succinylation | RKFFGLSKEDDVRDF HHHHCCCCCCCCHHH | 70.92 | 23954790 | |
149 | Acetylation | RKFFGLSKEDDVRDF HHHHCCCCCCCCHHH | 70.92 | 24489116 | |
149 | Ubiquitination | RKFFGLSKEDDVRDF HHHHCCCCCCCCHHH | 70.92 | 22106047 | |
163 | Phosphorylation | FVIRREVTKGEKTYT HHHEEEECCCCCCCC | 28.69 | 20377248 | |
164 | Acetylation | VIRREVTKGEKTYTK HHEEEECCCCCCCCC | 70.96 | 25381059 | |
164 | Succinylation | VIRREVTKGEKTYTK HHEEEECCCCCCCCC | 70.96 | 23954790 | |
167 | Acetylation | REVTKGEKTYTKAPK EEECCCCCCCCCCCH | 56.34 | 24489116 | |
171 | Ubiquitination | KGEKTYTKAPKIQRL CCCCCCCCCCHHHHH | 52.88 | - | |
171 | Acetylation | KGEKTYTKAPKIQRL CCCCCCCCCCHHHHH | 52.88 | 24489116 | |
180 | Phosphorylation | PKIQRLVTPQRLQRK CHHHHHCCHHHHHHH | 20.49 | 17287358 | |
214 | Ubiquitination | EYAQLLAKRLSERKA HHHHHHHHHHHHHHH | 54.57 | 22106047 | |
214 | Acetylation | EYAQLLAKRLSERKA HHHHHHHHHHHHHHH | 54.57 | 24489116 | |
214 | Succinylation | EYAQLLAKRLSERKA HHHHHHHHHHHHHHH | 54.57 | 23954790 | |
223 | Acetylation | LSERKAEKAEIRKRR HHHHHHHHHHHHHHH | 57.06 | 24489116 | |
232 | Phosphorylation | EIRKRRASSLKA--- HHHHHHHHHCCC--- | 34.10 | 19823750 | |
233 | Phosphorylation | IRKRRASSLKA---- HHHHHHHHCCC---- | 32.67 | 19823750 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS6A_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS6A_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS6A_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232 AND SER-233, ANDMASS SPECTROMETRY. | |
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232 AND SER-233, ANDMASS SPECTROMETRY. | |
"Phosphoproteome analysis by mass spectrometry and its application toSaccharomyces cerevisiae."; Ficarro S.B., McCleland M.L., Stukenberg P.T., Burke D.J., Ross M.M.,Shabanowitz J., Hunt D.F., White F.M.; Nat. Biotechnol. 20:301-305(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232 AND SER-233, ANDMASS SPECTROMETRY. | |
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-163 AND THR-180, ANDMASS SPECTROMETRY. |