UniProt ID | ADT3_YEAST | |
---|---|---|
UniProt AC | P18238 | |
Protein Name | ADP,ATP carrier protein 3 | |
Gene Name | AAC3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 307 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.. | |
Protein Sequence | MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFGKKFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | AIAKTAASPIERVKI HHHHHCCCHHHHHHH | 24.77 | 21440633 | |
64 | Acetylation | SGIVDCFKRTAKQEG CCHHHHHHHHHHHCC | 55.99 | 24489116 | |
97 | Ubiquitination | QALNFAFKDKIKLMF HHHHHHHHHHEEEEE | 55.47 | 17644757 | |
97 | Acetylation | QALNFAFKDKIKLMF HHHHHHHHHHEEEEE | 55.47 | 25381059 | |
99 | Ubiquitination | LNFAFKDKIKLMFGF HHHHHHHHEEEEECE | 42.19 | 17644757 | |
101 | Acetylation | FAFKDKIKLMFGFKK HHHHHHEEEEECEEC | 39.37 | 25381059 | |
107 | Acetylation | IKLMFGFKKEEGYGK EEEEECEECCCCCCC | 60.70 | 25381059 | |
163 | Phosphorylation | ARQFNGLTDVYKKTL CCCCCCCHHHHHHHH | 25.47 | 25533186 | |
248 | Phosphorylation | RRRMMMTSGQAVKYN HHHHHCCCCCCEECC | 15.83 | 27214570 | |
254 | Phosphorylation | TSGQAVKYNGAIDCL CCCCCEECCCHHHHH | 16.54 | 27017623 | |
275 | Acetylation | EGVGSLFKGCGANIL CCCHHHHCCCCHHHH | 59.59 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADT3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADT3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADT3_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...