UniProt ID | TRXB2_YEAST | |
---|---|---|
UniProt AC | P38816 | |
Protein Name | Thioredoxin reductase 2, mitochondrial | |
Gene Name | TRR2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 342 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Acts on mitochondrial thioredoxin 3. Implicated in the defense against oxidative stress.. | |
Protein Sequence | MIKHIVSPFRTNFVGISKSVLSRMIHHKVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMANGIAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPFRLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAKGDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSSLTSVPGFFAAGDVQDSRYRQAVTSAGSGCIAALDAERYLSAQE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | RMIHHKVTIIGSGPA HHHCCCEEEECCCHH | 16.22 | 22369663 | |
34 | Phosphorylation | HKVTIIGSGPAAHTA CCEEEECCCHHHHHH | 31.06 | 23749301 | |
40 | Phosphorylation | GSGPAAHTAAIYLAR CCCHHHHHHHHHHHH | 17.04 | 22369663 | |
44 | Phosphorylation | AAHTAAIYLARAEMK HHHHHHHHHHHHHCC | 6.92 | 22369663 | |
111 | Phosphorylation | NIITETVSKVDLSSK CCCCEECCCCCCCCC | 34.09 | 25315811 | |
302 | Phosphorylation | VPGSSLTSVPGFFAA CCCCCCCCCCCEEEC | 31.44 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRXB2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRXB2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRXB2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRXB1_YEAST | TRR1 | physical | 18719252 | |
TRX3_YEAST | TRX3 | physical | 18930846 | |
TRXB1_YEAST | TRR1 | genetic | 18408719 | |
TRX3_YEAST | TRX3 | genetic | 15701801 | |
ERG2_YEAST | ERG2 | genetic | 21623372 | |
GSHR_YEAST | GLR1 | genetic | 22770501 | |
TRX3_YEAST | TRX3 | genetic | 22770501 | |
MCA1_YEAST | MCA1 | genetic | 22770501 | |
PRX1_YEAST | PRX1 | genetic | 22770501 | |
TRXB2_YEAST | TRR2 | physical | 22940862 | |
TRXB1_YEAST | TRR1 | physical | 22940862 | |
CSN12_YEAST | YJR084W | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...