UniProt ID | TRX3_YEAST | |
---|---|---|
UniProt AC | P25372 | |
Protein Name | Thioredoxin-3, mitochondrial | |
Gene Name | TRX3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 127 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | ||
Protein Sequence | MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Succinylation | TEFRNLIKQNDKLVI HHHHHHHHHCCEEEE | 46.33 | 23954790 | |
67 | Acetylation | MMQPHLTKLIQAYPD HHHHHHHHHHHHCCC | 50.37 | 24489116 | |
72 | Phosphorylation | LTKLIQAYPDVRFVK HHHHHHHCCCCEEEE | 5.42 | 22369663 | |
79 | Acetylation | YPDVRFVKCDVDESP CCCCEEEECCCCCCC | 23.23 | 24489116 | |
92 | S-nitrosylation | SPDIAKECEVTAMPT CCCHHHHCEEEECCE | 5.13 | 22178444 | |
122 | Ubiquitination | ANPTALEKGIKDL-- CCHHHHHHHCCCC-- | 67.78 | 23749301 | |
122 | Acetylation | ANPTALEKGIKDL-- CCHHHHHHHCCCC-- | 67.78 | 24489116 | |
125 | Acetylation | TALEKGIKDL----- HHHHHHCCCC----- | 62.74 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRX3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRX3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRX3_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...