UniProt ID | VFA1_YEAST | |
---|---|---|
UniProt AC | P40080 | |
Protein Name | VPS4-associated protein 1 | |
Gene Name | VFA1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 203 | |
Subcellular Localization | Cytoplasm . Endosome . Requires VPS4 for its recruitment to endosomes. | |
Protein Description | VPS4-associated protein involved in trafficking to the vacuole.. | |
Protein Sequence | MINEYVARKVALKDMQPCAICSKPSTTVLYNASGPDWLYTCEIHLQDNPQFVIPLYSTEYNEAVAQLKLVKGKMDSLTSAQTQLGSWDGWVTKIFSKKEKETNNSKDPDPTTTDSTDTSPQAKNDAEILSETKKQYSKILDKVTELQRKNRKYELAKIMFESRLLRKRTEQVNRERYLKEQENYSNTDPEELLRKHVFPSVPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
115 | Phosphorylation | PDPTTTDSTDTSPQA CCCCCCCCCCCCHHH | 19779198 | ||
116 | Phosphorylation | DPTTTDSTDTSPQAK CCCCCCCCCCCHHHH | 28889911 | ||
118 | Phosphorylation | TTTDSTDTSPQAKND CCCCCCCCCHHHHHH | 27717283 | ||
119 | Phosphorylation | TTDSTDTSPQAKNDA CCCCCCCCHHHHHHH | 20377248 | ||
137 | Phosphorylation | SETKKQYSKILDKVT HHHHHHHHHHHHHHH | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VFA1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VFA1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VFA1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VPS4_YEAST | VPS4 | physical | 11283351 | |
VTA1_YEAST | VTA1 | physical | 18719252 | |
VPS4_YEAST | VPS4 | physical | 18719252 | |
VPS4_YEAST | VPS4 | physical | 21777356 | |
VPS4_YEAST | VPS4 | physical | 24567329 | |
RL8A_YEAST | RPL8A | genetic | 27708008 | |
YJ90_YEAST | YJR120W | genetic | 27708008 | |
SRO7_YEAST | SRO7 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27708008 | |
ATC7_YEAST | NEO1 | genetic | 27708008 | |
GWT1_YEAST | GWT1 | genetic | 27708008 | |
FUI1_YEAST | FUI1 | genetic | 27708008 | |
SIF2_YEAST | SIF2 | genetic | 27708008 | |
MCFS2_YEAST | EHT1 | genetic | 27708008 | |
RMD9L_YEAST | YBR238C | genetic | 27708008 | |
XRS2_YEAST | XRS2 | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
3HAO_YEAST | BNA1 | genetic | 27708008 | |
DHOM_YEAST | HOM6 | genetic | 27708008 | |
APN1_YEAST | APN1 | genetic | 27708008 | |
YKY5_YEAST | YKR005C | genetic | 27708008 | |
DID2_YEAST | DID2 | genetic | 27708008 | |
DOM34_YEAST | DOM34 | genetic | 27708008 | |
TOM7_YEAST | TOM7 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
PUS7_YEAST | PUS7 | genetic | 27708008 | |
UME1_YEAST | UME1 | genetic | 27708008 | |
KAR3_YEAST | KAR3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...