UniProt ID | ENV9_YEAST | |
---|---|---|
UniProt AC | Q08651 | |
Protein Name | Probable oxidoreductase ENV9 | |
Gene Name | ENV9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 330 | |
Subcellular Localization |
Lipid droplet . Membrane Multi-pass membrane protein . |
|
Protein Description | Probable dehydrogenase required for replication of Brome mosaic virus. Involved in vacuolar processing and morphology.. | |
Protein Sequence | MLDPRILPYYDPAVERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKTWDYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLVMNTNLFSYWTRLPIVGIFFWLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTGGKESKSSYVSNNVDEAASTWIWTVHQLRDRGFDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Ubiquitination | ICGRNSHKISKAIQE EECCCHHHHHHHHHH | 48.79 | 23749301 | |
282 | N-linked_Glycosylation | LKCALDPNLSVEKDN HEEEECCCCCEEECC | 44.61 | - | |
287 | Ubiquitination | DPNLSVEKDNGKYFT CCCCCEEECCCCEEE | 55.10 | 23749301 | |
301 | Ubiquitination | TTGGKESKSSYVSNN ECCCCCCCCCCCCCC | 44.50 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENV9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENV9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENV9_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...