| UniProt ID | ENV9_YEAST | |
|---|---|---|
| UniProt AC | Q08651 | |
| Protein Name | Probable oxidoreductase ENV9 | |
| Gene Name | ENV9 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 330 | |
| Subcellular Localization |
Lipid droplet . Membrane Multi-pass membrane protein . |
|
| Protein Description | Probable dehydrogenase required for replication of Brome mosaic virus. Involved in vacuolar processing and morphology.. | |
| Protein Sequence | MLDPRILPYYDPAVERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKTWDYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLVMNTNLFSYWTRLPIVGIFFWLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTGGKESKSSYVSNNVDEAASTWIWTVHQLRDRGFDI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Ubiquitination | ICGRNSHKISKAIQE EECCCHHHHHHHHHH | 48.79 | 23749301 | |
| 282 | N-linked_Glycosylation | LKCALDPNLSVEKDN HEEEECCCCCEEECC | 44.61 | - | |
| 287 | Ubiquitination | DPNLSVEKDNGKYFT CCCCCEEECCCCEEE | 55.10 | 23749301 | |
| 301 | Ubiquitination | TTGGKESKSSYVSNN ECCCCCCCCCCCCCC | 44.50 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENV9_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENV9_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENV9_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...