UniProt ID | CWC15_YEAST | |
---|---|---|
UniProt AC | Q03772 | |
Protein Name | Pre-mRNA-splicing factor CWC15 | |
Gene Name | CWC15 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 175 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing.. | |
Protein Sequence | MTTSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKFKEEENLRANCAQEDRSNDKSLEEAVMNEEKQDVVGSGNLQETRSEKDQKDSLQELLVTQKNKVEDKAELEGNEQLKGGNSSRRSWRKGTAFGRHKVTKETNIKEHATKKSASGYINDMTKSEYHQEFLHKHVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | GAKAAAYTPTGIEHA CCCCCCCCCCCHHHH | 15.06 | 28132839 | |
41 | Acetylation | HTTLKYRKFKEEENL CCCCCCCCCHHHHCH | 58.67 | 25381059 | |
62 | Phosphorylation | EDRSNDKSLEEAVMN CHHCCCHHHHHHHHC | 43.83 | 28889911 | |
88 | Acetylation | LQETRSEKDQKDSLQ HHHHCCHHHHHHHHH | 67.70 | 24489116 | |
104 | Acetylation | LLVTQKNKVEDKAEL HHHHHHCHHCCHHHH | 54.78 | 24489116 | |
108 | Acetylation | QKNKVEDKAELEGNE HHCHHCCHHHHCCCC | 30.19 | 24489116 | |
152 | Phosphorylation | KEHATKKSASGYIND HHHHCHHHHCCCCCC | 29.26 | 24961812 | |
154 | Phosphorylation | HATKKSASGYINDMT HHCHHHHCCCCCCCC | 38.94 | 24961812 | |
156 | Phosphorylation | TKKSASGYINDMTKS CHHHHCCCCCCCCHH | 8.28 | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC15_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC15_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC15_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-62, AND MASSSPECTROMETRY. |