| UniProt ID | TBP_YEAST | |
|---|---|---|
| UniProt AC | P13393 | |
| Protein Name | TATA-box-binding protein | |
| Gene Name | SPT15 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 240 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | General transcription factor that functions at the core of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.. | |
| Protein Sequence | MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Acetylation | KEFKEANKIVFDPNT HHHHHHHCCEECCCH | 47.50 | 24489116 | |
| 39 | Phosphorylation | DGTKPATTFQSEEDI CCCCCCCCCCCHHHH | 23.06 | 27214570 | |
| 42 | Phosphorylation | KPATTFQSEEDIKRA CCCCCCCCHHHHHHH | 38.47 | 21440633 | |
| 53 | Phosphorylation | IKRAAPESEKDTSAT HHHHCCCCCCCCCCC | 49.22 | 29688323 | |
| 57 | Phosphorylation | APESEKDTSATSGIV CCCCCCCCCCCCCCH | 31.18 | 29688323 | |
| 58 | Phosphorylation | PESEKDTSATSGIVP CCCCCCCCCCCCCHH | 39.42 | 29688323 | |
| 60 | Phosphorylation | SEKDTSATSGIVPTL CCCCCCCCCCCHHCH | 27.53 | 29688323 | |
| 61 | Phosphorylation | EKDTSATSGIVPTLQ CCCCCCCCCCHHCHH | 26.66 | 29688323 | |
| 66 | Phosphorylation | ATSGIVPTLQNIVAT CCCCCHHCHHHHHHH | 30.04 | 29688323 | |
| 73 | Phosphorylation | TLQNIVATVTLGCRL CHHHHHHHEEECCCC | 11.79 | 29688323 | |
| 75 | Phosphorylation | QNIVATVTLGCRLDL HHHHHHEEECCCCCH | 17.06 | 29688323 | |
| 83 | Acetylation | LGCRLDLKTVALHAR ECCCCCHHHHHHHHH | 40.39 | 24489116 | |
| 127 | Ubiquitination | KMVVTGAKSEDDSKL CEEEECCCCCCCHHH | 56.58 | 23749301 | |
| 133 | Ubiquitination | AKSEDDSKLASRKYA CCCCCCHHHHHHHHH | 55.88 | 23749301 | |
| 151 | Acetylation | QKIGFAAKFTDFKIQ HHHCCHHCCCCCEEE | 45.42 | 24489116 | |
| 151 | Ubiquitination | QKIGFAAKFTDFKIQ HHHCCHHCCCCCEEE | 45.42 | 23749301 | |
| 167 | Acetylation | IVGSCDVKFPIRLEG EECCCCEECCEEEEE | 31.97 | 24489116 | |
| 167 | Ubiquitination | IVGSCDVKFPIRLEG EECCCCEECCEEEEE | 31.97 | 23749301 | |
| 209 | Phosphorylation | IVLLIFVSGKIVLTG EEEEEEECCEEEEEC | 24.50 | 21126336 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBP_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBP_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBP_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-42, AND MASSSPECTROMETRY. | |