| UniProt ID | RRN9_YEAST | |
|---|---|---|
| UniProt AC | P53437 | |
| Protein Name | RNA polymerase I-specific transcription initiation factor RRN9 | |
| Gene Name | RRN9 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 365 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP UAF seems to stimulate basal transcription to a fully activated level.. | |
| Protein Sequence | MSDLDEESQIETQIDAPIEDIIRGSELTTTTADKETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQFVKTQIKDNWTSWPNPNTIIDPSVDKLYEDIPEGIANVSVQPGEISNRALMHASDMMRVELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHDKIAKENEFDVRQDKHSNNIRANQIDDEPMQANRRIKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIPEKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFIPVEKLLKDKRLTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIELPNGNI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSDLDEESQ ------CCCCCHHHH | 47.05 | 23607784 | |
| 8 | Phosphorylation | MSDLDEESQIETQID CCCCCHHHHHHHHCC | 34.12 | 23607784 | |
| 12 | Phosphorylation | DEESQIETQIDAPIE CHHHHHHHHCCCCHH | 32.24 | 23607784 | |
| 245 | Phosphorylation | CEMNEDMTDIYMKSL CCCCCCHHHHHHHHH | 31.41 | 27017623 | |
| 248 | Phosphorylation | NEDMTDIYMKSLELY CCCHHHHHHHHHHHH | 10.99 | 27017623 | |
| 349 | Phosphorylation | LEDENEISDYELDDC ECCCCCCCCCCCCCC | 28.14 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRN9_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRN9_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRN9_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
