| UniProt ID | RRN10_YEAST | |
|---|---|---|
| UniProt AC | P38204 | |
| Protein Name | RNA polymerase I-specific transcription initiation factor RRN10 | |
| Gene Name | RRN10 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 145 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP UAF seems to stimulate basal transcription to a fully activated level.. | |
| Protein Sequence | MDRNVYEACSNIIKEFGTHVVSADEVLAEKIDNAVPIPFKTREEIDADVEKDRNEGVFEGNIIPDIDLRVVHYYATQLCLNKYPHLINAFDETSLITLGLLIEKWVKDYLTSIQTEQGRQSKVIGKGPCEFISKHIDYRHAPGNI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of RRN10_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRN10_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRN10_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRN10_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATG20_YEAST | ATG20 | physical | 10688190 | |
| TBP_YEAST | SPT15 | genetic | 10866683 | |
| RRN9_YEAST | RRN9 | physical | 18719252 | |
| NOP15_YEAST | NOP15 | genetic | 22608550 | |
| RL40A_YEAST | RPL40B | genetic | 23669742 | |
| RL40B_YEAST | RPL40B | genetic | 23669742 | |
| RRN9_YEAST | RRN9 | physical | 29357286 | |
| RRN5_YEAST | RRN5 | physical | 29357286 | |
| RRN10_YEAST | RRN10 | physical | 29357286 | |
| H3_YEAST | HHT1 | physical | 29357286 | |
| H4_YEAST | HHF1 | physical | 29357286 | |
| UAF30_YEAST | UAF30 | physical | 29357286 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
