UniProt ID | SCM4_YEAST | |
---|---|---|
UniProt AC | P32564 | |
Protein Name | Protein SCM4 | |
Gene Name | SCM4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 187 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MQVSPAIVKGIAVSSLGLYAGILTSSTVISITTPINVLTQHLKNVLCTLGCWSTVLGGLATGAFGLSYYLAAPGERPNYLLCGLGVAPLSAAYLYLVSLFNHKLAPKCTRDQNDLEKQKDEKLPQHHPEVKDGEAACPFSKMNNAKTLKPESERSVKCHSYMSLHMSIVTGITIFTFGKCILDGFKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
140 | Phosphorylation | GEAACPFSKMNNAKT CCCCCCHHHCCCCCC | 19.01 | 27017623 | |
149 | Ubiquitination | MNNAKTLKPESERSV CCCCCCCCCCCHHHH | 52.55 | 23749301 | |
152 | Phosphorylation | AKTLKPESERSVKCH CCCCCCCCHHHHHHC | 47.00 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCM4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCM4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCM4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TOM40_YEAST | TOM40 | physical | 21825073 | |
MIM1_YEAST | MIM1 | physical | 21825073 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
ERG3_YEAST | ERG3 | genetic | 27708008 | |
UBX2_YEAST | UBX2 | genetic | 27708008 | |
ERG2_YEAST | ERG2 | genetic | 27708008 | |
ATG3_YEAST | ATG3 | genetic | 27708008 | |
BEM4_YEAST | BEM4 | genetic | 27708008 | |
KAR3_YEAST | KAR3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...