UniProt ID | MIM1_YEAST | |
---|---|---|
UniProt AC | Q08176 | |
Protein Name | Mitochondrial import protein 1 | |
Gene Name | MIM1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 113 | |
Subcellular Localization | Mitochondrion outer membrane . | |
Protein Description | Required for the assembly of the TOM (translocase of outer membrane) receptor complex, which is responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.. | |
Protein Sequence | MTEVVGFWESVSDDESEDKDCMEVQNTVSADESPLVQSLVSFVGSCSINLLLPFLNGMMLGFGELFAHELCWRFNWFNHRNKGYKVYPESRKIAALKEISSPGTRGRVASKFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | VGFWESVSDDESEDK EEEEECCCCCCCCCC | 48.93 | 27717283 | |
16 | Phosphorylation | ESVSDDESEDKDCME ECCCCCCCCCCCHHC | 59.08 | 27717283 | |
90 | Phosphorylation | GYKVYPESRKIAALK CCEECCHHHHHHHHH | 34.08 | 19779198 | |
100 | Phosphorylation | IAALKEISSPGTRGR HHHHHHCCCCCCCCC | 31.41 | 19823750 | |
101 | Phosphorylation | AALKEISSPGTRGRV HHHHHCCCCCCCCCH | 32.77 | 19823750 | |
104 | Phosphorylation | KEISSPGTRGRVASK HHCCCCCCCCCHHHH | 33.08 | 19823750 | |
110 | Phosphorylation | GTRGRVASKFL---- CCCCCHHHHCC---- | 22.53 | 19823750 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIM1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIM1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIM1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TOM5_YEAST | TOM5 | genetic | 20668160 | |
UGO1_YEAST | UGO1 | physical | 21825074 | |
TOM20_YEAST | TOM20 | physical | 21825073 | |
UGO1_YEAST | UGO1 | physical | 21825073 | |
TOM70_YEAST | TOM70 | physical | 21825073 | |
YL099_YEAST | MIM2 | physical | 22467864 | |
YL099_YEAST | MIM2 | genetic | 22467864 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...