| UniProt ID | TOM5_YEAST | |
|---|---|---|
| UniProt AC | P80967 | |
| Protein Name | Mitochondrial import receptor subunit TOM5 | |
| Gene Name | TOM5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 50 | |
| Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . Outer membrane-anchored. |
|
| Protein Description | Component of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. TOM5 is involved in insertion of preproteins into the TOM40 translocation pore.. | |
| Protein Sequence | MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM5_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TOM40_YEAST | TOM40 | physical | 11276259 | |
| TOM20_YEAST | TOM20 | physical | 9774667 | |
| TOM22_YEAST | TOM22 | physical | 9774667 | |
| TAZ1_YEAST | TAZ1 | genetic | 19962311 | |
| CRD1_YEAST | CRD1 | genetic | 19962311 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| TOM6_YEAST | TOM6 | genetic | 20668160 | |
| SAM35_YEAST | SAM35 | physical | 20026336 | |
| SAM37_YEAST | SAM37 | physical | 20026336 | |
| TOM20_YEAST | TOM20 | physical | 20026336 | |
| CSN12_YEAST | YJR084W | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| NDH2_YEAST | NDE2 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| BLM10_YEAST | BLM10 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| EMC2_YEAST | EMC2 | genetic | 27708008 | |
| UBX2_YEAST | UBX2 | genetic | 27708008 | |
| CSM3_YEAST | CSM3 | genetic | 27708008 | |
| MKS1_YEAST | MKS1 | genetic | 27708008 | |
| EOS1_YEAST | EOS1 | genetic | 27708008 | |
| DIA2_YEAST | DIA2 | genetic | 27708008 | |
| IDH2_YEAST | IDH2 | genetic | 27708008 | |
| RU2A_YEAST | LEA1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
