| UniProt ID | NCB1_YEAST | |
|---|---|---|
| UniProt AC | P40096 | |
| Protein Name | Negative cofactor 2 complex subunit alpha | |
| Gene Name | BUR6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 142 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the NC2 complex which represses RNA polymerase II transcription through binding to SPT15/TBP and thereby inhibiting the assembly of the preinitiation complex. The NC2 complex may also mediate transcriptional activation from TATA-driven promoters through association with SPT15/TBP.. | |
| Protein Sequence | MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELGDVFDRIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEKFDFLREGLCVEEGQTQPEEESA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MADQVPVTTQLPPIK CCCCCCCCCCCCCCC | 11.62 | 19823750 | |
| 9 | Phosphorylation | ADQVPVTTQLPPIKP CCCCCCCCCCCCCCC | 28.48 | 19823750 | |
| 27 | Phosphorylation | VPLDAGGSPVGNMGT CCCCCCCCCCCCCCC | 18.59 | 19823750 | |
| 34 | Phosphorylation | SPVGNMGTNSNNNNE CCCCCCCCCCCCCCC | 25.38 | 19823750 | |
| 36 | Phosphorylation | VGNMGTNSNNNNELG CCCCCCCCCCCCCHH | 40.55 | 19823750 | |
| 64 | Phosphorylation | KVKKIMQTDEDIGKV HHHHHHCCCCCHHHH | 24.79 | 12502746 | |
| 72 | Phosphorylation | DEDIGKVSQATPVIA CCCHHHHCCCCCEEC | 19.99 | 21126336 | |
| 75 | Phosphorylation | IGKVSQATPVIAGRS HHHHCCCCCEECCCC | 15.51 | 28132839 | |
| 120 | Acetylation | KTILNDEKFDFLREG HHHCCHHHCCHHHHC | 53.77 | 24489116 | |
| 135 | Phosphorylation | LCVEEGQTQPEEESA CCCCCCCCCCHHHCC | 57.88 | 22890988 | |
| 141 | Phosphorylation | QTQPEEESA------ CCCCHHHCC------ | 42.43 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NCB1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NCB1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NCB1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27 AND SER-141, AND MASSSPECTROMETRY. | |
