| UniProt ID | TIM14_YEAST | |
|---|---|---|
| UniProt AC | Q07914 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM14 | |
| Gene Name | PAM18 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 168 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to stimulate activity of mtHSP70 (SSC1).. | |
| Protein Sequence | MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | AFLTLYFTAGAYKSI HHHHHHHHHHHHHHH | 15.60 | 27017623 | |
| 83 | Phosphorylation | LYFTAGAYKSISKGL HHHHHHHHHHHHCCC | 12.35 | 27017623 | |
| 101 | Acetylation | KSTTAFLKGGFDPKM CCHHHHHCCCCCCCC | 51.00 | 24489116 | |
| 120 | Phosphorylation | ALQILNLTENTLTKK HHHHHCCCCCCCCHH | 26.56 | 28889911 | |
| 125 | Phosphorylation | NLTENTLTKKKLKEV CCCCCCCCHHHHHHH | 38.49 | 28889911 | |
| 126 | Acetylation | LTENTLTKKKLKEVH CCCCCCCHHHHHHHH | 51.53 | 24489116 | |
| 144 | Acetylation | MLANHPDKGGSPFLA HHHCCCCCCCCCCHH | 70.40 | 22865919 | |
| 158 | Acetylation | ATKINEAKDFLEKRG HHHHHHHHHHHHHCC | 42.72 | 24489116 | |
| 163 | Acetylation | EAKDFLEKRGISK-- HHHHHHHHCCCCC-- | 59.06 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM14_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM14_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM14_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
