| UniProt ID | RHO3_YEAST | |
|---|---|---|
| UniProt AC | Q00245 | |
| Protein Name | GTP-binding protein RHO3 | |
| Gene Name | RHO3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 231 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Plays an important role in cell growth. Required to keep the uninucleated state. May be involved in the organization of the cytoskeleton which affects microtubule functions. Most likely RHO3 and RHO4 of S.cerevisiae regulate partially overlapping but different pathways.. | |
| Protein Sequence | MSFLCGSASTSNKPIERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVALTAGPVATEVKSDSGSSCTIM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSFLCGSAS ------CCCCCCCCC | 27.25 | 30377154 | |
| 5 | S-palmitoylation | ---MSFLCGSASTSN ---CCCCCCCCCCCC | 3.69 | 16751107 | |
| 9 | Phosphorylation | SFLCGSASTSNKPIE CCCCCCCCCCCCCCE | 33.78 | 30377154 | |
| 11 | Phosphorylation | LCGSASTSNKPIERK CCCCCCCCCCCCEEE | 40.12 | 30377154 | |
| 13 | Acetylation | GSASTSNKPIERKIV CCCCCCCCCCEEEEE | 47.33 | 25381059 | |
| 18 | Ubiquitination | SNKPIERKIVILGDG CCCCCEEEEEEECCC | 28.65 | 17644757 | |
| 29 | Ubiquitination | LGDGACGKTSLLNVF ECCCCCCCHHHHHHH | 34.52 | 17644757 | |
| 109 | Ubiquitination | SLENVQNKWVGEITD HHHHHHHHCHHHHHH | 26.60 | 23749301 | |
| 139 | Phosphorylation | LRNNENESNAITPNN CCCCCCCCCCCCCCC | 43.05 | 23749301 | |
| 143 | Phosphorylation | ENESNAITPNNIQQD CCCCCCCCCCCHHCC | 19.97 | 23749301 | |
| 152 | Phosphorylation | NNIQQDNSVSNDNGN CCHHCCCCCCCCCCC | 34.90 | 21440633 | |
| 154 | Phosphorylation | IQQDNSVSNDNGNNI HHCCCCCCCCCCCCC | 37.98 | 21440633 | |
| 163 | Phosphorylation | DNGNNINSTSNGKNL CCCCCCCCCCCCCCC | 29.43 | 23749301 | |
| 164 | Phosphorylation | NGNNINSTSNGKNLI CCCCCCCCCCCCCCC | 23.02 | 21551504 | |
| 165 | Phosphorylation | GNNINSTSNGKNLIS CCCCCCCCCCCCCCC | 43.32 | 23749301 | |
| 181 | Ubiquitination | EEGLAMAKKIGALRY HHHHHHHHHHHHHHH | 31.66 | 23749301 | |
| 194 | Ubiquitination | RYLECSAKLNKGVNE HHHHHHHHCCCCHHH | 35.98 | 23749301 | |
| 197 | Ubiquitination | ECSAKLNKGVNEAFT HHHHHCCCCHHHHHH | 74.75 | 23749301 | |
| 228 | Methylation | KSDSGSSCTIM---- ECCCCCCCEEC---- | 2.98 | - | |
| 228 | Farnesylation | KSDSGSSCTIM---- ECCCCCCCEEC---- | 2.98 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...