| UniProt ID | KTR3_YEAST | |
|---|---|---|
| UniProt AC | P38130 | |
| Protein Name | Probable mannosyltransferase KTR3 | |
| Gene Name | KTR3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 404 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
| Protein Description | Possible glycosyltransferase that transfers an alpha-D-mannosyl residue from GDP-mannose into lipid-linked oligosaccharide, forming an alpha-(1->2)-D-mannosyl-D-mannose linkage.. | |
| Protein Sequence | MSVHHKKKLMPKSALLIRKYQKGIRSSFIGLIIVLSFLFFMSGSRSPEVPIAQGTSVSRVASKDYLMPFTDKSQGVIHPVDDGKKEKGVMVTLARNSDLWNLVKSIRHVEDRFNNRYHYDWVFLNDQPFSDEFKRVTSALVSGKAKYGTIPKDHWSIPSWIDTEKFDEKRLAMGKLDIPYGSSVPYRHMCRFQSGFIWRHPLLEEYEWFWRVDTDITLFCDIQYDIFKFLKVNNKKYGFILSVSEYERTIPTLWETTKKFIKKNPKFLHKNNLMKFISNDDGDTYNMCHFWTNFEIGSLDFFRSDAYREYFDYLDSSGGFFYERWGDAPVHSIAASLFLDKSEIHFFDGLGFHHPDFTSCPIEQKIRLQNKCICEPSKDVTWTPDYFCTRKYFSAGNYKLPPGI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Ubiquitination | HKKKLMPKSALLIRK CCCCCCCHHHHHHHH | 34.10 | 23749301 | |
| 63 | Acetylation | SVSRVASKDYLMPFT CCCEECCCCEECCCC | 40.43 | 24489116 | |
| 72 | Ubiquitination | YLMPFTDKSQGVIHP EECCCCCCCCCCEEE | 41.44 | 17644757 | |
| 84 | Ubiquitination | IHPVDDGKKEKGVMV EEECCCCCCCCCEEE | 65.83 | 17644757 | |
| 85 | Ubiquitination | HPVDDGKKEKGVMVT EECCCCCCCCCEEEE | 70.91 | 17644757 | |
| 87 | Ubiquitination | VDDGKKEKGVMVTLA CCCCCCCCCEEEEEE | 66.73 | 17644757 | |
| 104 | Acetylation | SDLWNLVKSIRHVED HHHHHHHHHHHHHHH | 43.25 | 24489116 | |
| 137 | Phosphorylation | SDEFKRVTSALVSGK CHHHHHHHHHHHCCC | 16.59 | 19823750 | |
| 138 | Phosphorylation | DEFKRVTSALVSGKA HHHHHHHHHHHCCCC | 19.42 | 19823750 | |
| 142 | Phosphorylation | RVTSALVSGKAKYGT HHHHHHHCCCCCCCC | 35.11 | 19823750 | |
| 175 | Acetylation | EKRLAMGKLDIPYGS HHHHHCCCCCCCCCC | 29.87 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KTR3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KTR3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KTR3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...