| UniProt ID | ERV46_YEAST | |
|---|---|---|
| UniProt AC | P39727 | |
| Protein Name | ER-derived vesicles protein ERV46 | |
| Gene Name | ERV46 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 415 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Recycles between endoplasmic reticulum and Golgi. Resides in the endoplasmic and Golgi compartments, and then packaged into endoplasmi |
|
| Protein Description | Constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi. The C-terminal Phe-Tyr motif is required for exit from the endoplasmic reticulum. Facilitates retrograde transport from the Golgi to the endoplasmic reticulum.. | |
| Protein Sequence | MKRSTLLSLDAFAKTEEDVRVRTRAGGLITLSCILTTLFLLVNEWGQFNSVVTRPQLVVDRDRHAKLELNMDVTFPSMPCDLVNLDIMDDSGEMQLDILDAGFTMSRLNSEGRPVGDATELHVGGNGDGTAPVNNDPNYCGPCYGAKDQSQNENLAQEEKVCCQDCDAVRSAYLEAGWAFFDGKNIEQCEREGYVSKINEHLNEGCRIKGSAQINRIQGNLHFAPGKPYQNAYGHFHDTSLYDKTSNLNFNHIINHLSFGKPIQSHSKLLGNDKRHGGAVVATSPLDGRQVFPDRNTHFHQFSYFAKIVPTRYEYLDNVVIETAQFSATFHSRPLAGGRDKDHPNTLHVRGGIPGMFVFFEMSPLKVINKEQHGQTWSGFILNCITSIGGVLAVGTVMDKLFYKAQRSIWGKKSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MKRSTLLSLDAF ---CCCCCEEEHHHH | 35.43 | 27017623 | |
| 8 | Phosphorylation | MKRSTLLSLDAFAKT CCCCCEEEHHHHCCC | 27.58 | 27017623 | |
| 15 | Phosphorylation | SLDAFAKTEEDVRVR EHHHHCCCHHHHHHH | 40.97 | 27017623 | |
| 227 | Ubiquitination | NLHFAPGKPYQNAYG CEEECCCCCCCCCCC | 39.22 | 17644757 | |
| 227 | Acetylation | NLHFAPGKPYQNAYG CEEECCCCCCCCCCC | 39.22 | 24489116 | |
| 244 | Ubiquitination | HDTSLYDKTSNLNFN CCCCCCCCCCCCCHH | 40.05 | 17644757 | |
| 261 | Ubiquitination | INHLSFGKPIQSHSK HHHHHCCCCCCCCHH | 36.62 | 17644757 | |
| 268 | Ubiquitination | KPIQSHSKLLGNDKR CCCCCCHHHHCCCCC | 42.16 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERV46_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERV46_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERV46_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
