YIC9_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YIC9_YEAST
• UniProt AC: P40538
• Protein Name: Uncharacterized protein YIL029C
• Gene Name: YIL029C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 142
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MRLIFIAKMLQYSFLPFSPFNLLNFDNSISVSWFITYSVIVSIWGFAVWIEGAYRNKINLQLPRCTKIKCSRYNTRIKSPKWFNCKNWMHFFLLYLFLTASNLIVQLAYFSKEMCSQGINVPGTKKPGNRVYLSVIILMGNG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YIC9_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YIC9_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YIC9_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YIC9_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MSC1_YEAST	MSC1	genetic	19325107
PLMT_YEAST	OPI3	genetic	19325107
PHO80_YEAST	PHO80	genetic	19325107
LHS1_YEAST	LHS1	genetic	19325107
SPC2_YEAST	SPC2	genetic	19325107
DOA10_YEAST	SSM4	genetic	19325107
STE24_YEAST	STE24	genetic	19325107

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.