| UniProt ID | PAU23_YEAST | |
|---|---|---|
| UniProt AC | Q07987 | |
| Protein Name | Seripauperin-23 | |
| Gene Name | PAU23 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 124 | |
| Subcellular Localization | Secreted, cell wall. | |
| Protein Description | Component of the cell wall.. | |
| Protein Sequence | MVKLTSIVAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSKDGIYTAVPN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU23_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU23_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU23_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAF12_YEAST | TAF12 | genetic | 27708008 | |
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| SCC1_YEAST | MCD1 | genetic | 27708008 | |
| GLE1_YEAST | GLE1 | genetic | 27708008 | |
| TCPZ_YEAST | CCT6 | genetic | 27708008 | |
| CAB5_YEAST | CAB5 | genetic | 27708008 | |
| TSC11_YEAST | TSC11 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| CDC14_YEAST | CDC14 | genetic | 27708008 | |
| PRS8_YEAST | RPT6 | genetic | 27708008 | |
| MET30_YEAST | MET30 | genetic | 27708008 | |
| NTR2_YEAST | NTR2 | genetic | 27708008 | |
| SC61A_YEAST | SEC61 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| BET5_YEAST | BET5 | genetic | 27708008 | |
| TAF4_YEAST | TAF4 | genetic | 27708008 | |
| HRP1_YEAST | HRP1 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| SYH_YEAST | HTS1 | genetic | 27708008 | |
| ARP7_YEAST | ARP7 | genetic | 27708008 | |
| PSB5_YEAST | PRE2 | genetic | 27708008 | |
| MED10_YEAST | NUT2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...