UniProt ID | PAU23_YEAST | |
---|---|---|
UniProt AC | Q07987 | |
Protein Name | Seripauperin-23 | |
Gene Name | PAU23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 124 | |
Subcellular Localization | Secreted, cell wall. | |
Protein Description | Component of the cell wall.. | |
Protein Sequence | MVKLTSIVAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSKDGIYTAVPN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU23_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAF12_YEAST | TAF12 | genetic | 27708008 | |
CALM_YEAST | CMD1 | genetic | 27708008 | |
SCC1_YEAST | MCD1 | genetic | 27708008 | |
GLE1_YEAST | GLE1 | genetic | 27708008 | |
TCPZ_YEAST | CCT6 | genetic | 27708008 | |
CAB5_YEAST | CAB5 | genetic | 27708008 | |
TSC11_YEAST | TSC11 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
CDC14_YEAST | CDC14 | genetic | 27708008 | |
PRS8_YEAST | RPT6 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
NTR2_YEAST | NTR2 | genetic | 27708008 | |
SC61A_YEAST | SEC61 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
BET5_YEAST | BET5 | genetic | 27708008 | |
TAF4_YEAST | TAF4 | genetic | 27708008 | |
HRP1_YEAST | HRP1 | genetic | 27708008 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
SYH_YEAST | HTS1 | genetic | 27708008 | |
ARP7_YEAST | ARP7 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 | |
MED10_YEAST | NUT2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...