NCE2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NCE2_YEAST
• UniProt AC: Q12207
• Protein Name: Non-classical export protein 2
• Gene Name: NCE102
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 173
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Associates with the ergosterol-rich membrane compartment of CAN1 (MCC). Accumulates in membrane domains at eisosomes.
• Protein Description: Involved in membrane organization. Required for the formation of membrane compartments of CAN1 (MCCs), localization of CAN1 at the MCCs and subsequent invagination of the plasma membrane at the MCCs sites. Involved in eisosome organization and might act as a sensor of sphingolipids that regulates plasma membrane function. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence. It may be an accessory subunit to an essential core component of the non-classical export machinery. Non-classical export pathway functions also as an alternative clearance/detoxification pathway to eliminate damaged material, when the basic repair pathway is not sufficient..
• Protein Sequence: MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFANFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
108	Ubiquitination	SSYVDSNKITQGSGT CCCCCCCCCCCCCCH	51.59	22817900
138	Phosphorylation	CAIFLAKTLMSVFNM HHHHHHHHHHHHHHH	23.30	30377154
153	Phosphorylation	ISNGAFGSGSFSKRR HHCCCCCCCCCCCCC	25.47	30377154
155	Phosphorylation	NGAFGSGSFSKRRRT CCCCCCCCCCCCCCC	28.22	30377154
162	Phosphorylation	SFSKRRRTGQVGVPT CCCCCCCCCCCCCCC	30.10	22890988
169	Phosphorylation	TGQVGVPTISQV--- CCCCCCCCCCCC---	30.74	22890988
171	Phosphorylation	QVGVPTISQV----- CCCCCCCCCC-----	27.63	22890988

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NCE2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NCE2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NCE2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PGA3_YEAST	PGA3	genetic	16269340
YNJ5_YEAST	YNL095C	genetic	16269340
TSC3_YEAST	TSC3	genetic	16269340
SHR3_YEAST	SHR3	genetic	16269340
CHO2_YEAST	CHO2	genetic	16269340
FHN1_YEAST	FHN1	genetic	20581291
NCE2_SCHPO	fhn1	genetic	20581291
VPS54_YEAST	VPS54	genetic	21987634
RV167_YEAST	RVS167	genetic	21987634
PGA3_YEAST	PGA3	genetic	21987634
CYK2_YEAST	HOF1	genetic	21987634
YNJ5_YEAST	YNL095C	genetic	21987634
GEP3_YEAST	GEP3	genetic	21987634
RIC1_YEAST	RIC1	genetic	23891562
BPH1_YEAST	BPH1	genetic	23891562
ARPC1_YEAST	ARC40	genetic	27708008
TRS20_YEAST	TRS20	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
ARP4_YEAST	ARP4	genetic	27708008
PRI2_YEAST	PRI2	genetic	27708008
GSP1_YEAST	GSP1	genetic	27708008
ORC1_YEAST	ORC1	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
CAP_YEAST	SRV2	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
CR3L1_HUMAN	CREB3L1	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.