| UniProt ID | FHN1_YEAST | |
|---|---|---|
| UniProt AC | P53279 | |
| Protein Name | Non-classical export protein 2 homolog 1 | |
| Gene Name | FHN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 174 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Associates with the ergosterol-rich membrane compartment of CAN1 (MCC). Accumulates in membrane domains at eisosomes.. |
|
| Protein Description | Involved in membrane organization. Required for the formation of membrane compartments of CAN1 (MCCs), localization of CAN1 at the MCCs and subsequent invagination of the plasma membrane at the MCCs sites. Involved in eisosome organization and might act as a sensor of sphingolipids that regulates plasma membrane function. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence. Non-classical export pathway functions also as an alternative clearance/detoxification pathway to eliminate damaged material, when the basic repair pathway is not sufficient.. | |
| Protein Sequence | MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLANFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FHN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FHN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FHN1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YBI6_YEAST | YBL086C | genetic | 27708008 | |
| KMO_YEAST | BNA4 | genetic | 27708008 | |
| YAJ9_YEAST | YAR029W | genetic | 27708008 | |
| RL19A_YEAST | RPL19B | genetic | 27708008 | |
| RL19B_YEAST | RPL19B | genetic | 27708008 | |
| RS8A_YEAST | RPS8A | genetic | 27708008 | |
| RS8B_YEAST | RPS8A | genetic | 27708008 | |
| YBM6_YEAST | YBR016W | genetic | 27708008 | |
| RMD1_YEAST | RMD1 | genetic | 27708008 | |
| YD012_YEAST | YDL012C | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| PEX19_YEAST | PEX19 | genetic | 27708008 | |
| NDH2_YEAST | NDE2 | genetic | 27708008 | |
| LSB3_YEAST | LSB3 | genetic | 27708008 | |
| PEX2_YEAST | PEX2 | genetic | 27708008 | |
| YJ24_YEAST | KCH1 | genetic | 27708008 | |
| IXR1_YEAST | IXR1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
