| UniProt ID | YD012_YEAST | |
|---|---|---|
| UniProt AC | Q12489 | |
| Protein Name | Cysteine-rich and transmembrane domain-containing protein YDL012C | |
| Gene Name | YDL012C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 107 | |
| Subcellular Localization |
Cell membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MSAQDYYGNSASKQSYSRPSAPPPGYETASRGYAPSQSQQNYYPPQQQQQQYQQQPQYYQQQQPQYYQQHPQQPIYVQQQPASSGNEDCLAGCLAGLCLCCTLDMLF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAQDYYGN ------CCHHHHCCC | 34.34 | 22814378 | |
| 2 | Phosphorylation | ------MSAQDYYGN ------CCHHHHCCC | 34.34 | 22369663 | |
| 13 | Ubiquitination | YYGNSASKQSYSRPS HCCCCCCCCCCCCCC | 42.87 | 24961812 | |
| 15 | Phosphorylation | GNSASKQSYSRPSAP CCCCCCCCCCCCCCC | 28.89 | 30377154 | |
| 16 | Phosphorylation | NSASKQSYSRPSAPP CCCCCCCCCCCCCCC | 13.25 | 23749301 | |
| 17 | Phosphorylation | SASKQSYSRPSAPPP CCCCCCCCCCCCCCC | 42.85 | 30377154 | |
| 20 | Phosphorylation | KQSYSRPSAPPPGYE CCCCCCCCCCCCCCC | 52.91 | 23749301 | |
| 26 | Phosphorylation | PSAPPPGYETASRGY CCCCCCCCCCCCCCC | 18.84 | 23749301 | |
| 28 | Phosphorylation | APPPGYETASRGYAP CCCCCCCCCCCCCCC | 22.81 | 28132839 | |
| 30 | Phosphorylation | PPGYETASRGYAPSQ CCCCCCCCCCCCCCH | 33.39 | 28889911 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD012_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD012_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GDS1_YEAST | GDS1 | physical | 10688190 | |
| NADC_YEAST | BNA6 | physical | 10688190 | |
| ERC1_YEAST | ERC1 | physical | 10688190 | |
| YHU0_YEAST | YHR140W | physical | 10688190 | |
| DLS1_YEAST | DLS1 | physical | 10688190 | |
| CDC42_YEAST | CDC42 | genetic | 27708008 | |
| LIP1_YEAST | LIP1 | genetic | 27708008 | |
| KPR4_YEAST | PRS4 | genetic | 27708008 | |
| GAL10_YEAST | GAL10 | genetic | 27708008 | |
| RIM1_YEAST | RIM1 | genetic | 27708008 | |
| RAD4_YEAST | RAD4 | genetic | 27708008 | |
| TFS2_YEAST | DST1 | genetic | 27708008 | |
| GCN1_YEAST | GCN1 | genetic | 27708008 | |
| YGY5_YEAST | YGL235W | genetic | 27708008 | |
| KSS1_YEAST | KSS1 | genetic | 27708008 | |
| AIM18_YEAST | AIM18 | genetic | 27708008 | |
| HAP4_YEAST | HAP4 | genetic | 27708008 | |
| LDB18_YEAST | LDB18 | genetic | 27708008 | |
| RL22A_YEAST | RPL22A | genetic | 27708008 | |
| RL6B_YEAST | RPL6B | genetic | 27708008 | |
| DAK1_YEAST | DAK1 | genetic | 27708008 | |
| ASND1_YEAST | YML096W | genetic | 27708008 | |
| YMS4_YEAST | YMR034C | genetic | 27708008 | |
| PET8_YEAST | PET8 | genetic | 27708008 | |
| COX5A_YEAST | COX5A | genetic | 27708008 | |
| YNF8_YEAST | YNL058C | genetic | 27708008 | |
| MSH2_YEAST | MSH2 | genetic | 27708008 | |
| COQ7_YEAST | CAT5 | genetic | 27708008 | |
| RDL1_YEAST | RDL1 | genetic | 27708008 | |
| MTHR1_YEAST | MET12 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...