NCE2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NCE2_SCHPO
• UniProt AC: O74333
• Protein Name: Non-classical export protein 2 homolog
• Gene Name: fhn1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 183
• Subcellular Localization: Cytoplasm . Golgi apparatus membrane ; Multi-pass membrane protein . Cell membrane; Multi-pass membrane protein.
• Protein Description: Involved in membrane organization and might act as a sensor of sphingolipids that regulates plasma membrane function. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence..
• Protein Sequence: MVGIRQYGVFTWVFRTFQLAIDTIVLALASALVNQQTSGGSPGKINFSVAVGSFAILTFFLTAVGRFLPTILGNPWLIAFYDFVNWVFALTGGCCIAVAIRVHACDNQKYLDRNHYTQGSMRRCQELKALCFFLWFMFGLYVASFIVQIFIAKNDTPNYTFRGRGRGKGSGPAVAPRPVMSAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
170	Phosphorylation	GRGRGKGSGPAVAPR CCCCCCCCCCCCCCC	45.12	25720772
181	Phosphorylation	VAPRPVMSAV----- CCCCCCCCCC-----	26.55	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NCE2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NCE2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NCE2_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of NCE2_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.