| UniProt ID | DIC1_YEAST | |
|---|---|---|
| UniProt AC | Q06143 | |
| Protein Name | Mitochondrial dicarboxylate transporter | |
| Gene Name | DIC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 298 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Mitochondrial dicarboxylic transporter catalyzing the exchange of dicarboxylic acids like malate and succinate for inorganic phosphate. Required for growth on ethanol and acetate.. | |
| Protein Sequence | MSTNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKEDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 93 | Acetylation | FGAYDLLKENVIPRE CCHHHHHHHCCCCHH | 55.32 | 24489116 | |
| 156 | Acetylation | NAIDGVYKIYRYEGG HHHCHHHEEEEECCC | 30.75 | 24489116 | |
| 165 | Acetylation | YRYEGGLKTLFTGWK EEECCCHHCHHCCCC | 46.59 | 24489116 | |
| 208 | Phosphorylation | DFDASKNYTHLTASL CCCCCCCCHHHHHHH | 10.16 | 27017623 | |
| 214 | Phosphorylation | NYTHLTASLLAGLVA CCHHHHHHHHHHHHH | 20.76 | 27017623 | |
| 223 | Phosphorylation | LAGLVATTVCSPADV HHHHHHHCCCCHHHH | 15.13 | 27017623 | |
| 259 | Phosphorylation | AVRKEGPSFMFRGWL HHHHHCCCCHHCCCC | 39.95 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
