YJV8_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YJV8_YEAST
• UniProt AC: P40892
• Protein Name: Putative acetyltransferase YJL218W
• Gene Name: YJL218W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 196
• Protein Sequence: MGVLENIVPGELYDANYDPDLLKIRKETKIKLHEYNTLSPADENKKSQVIRELLGSCTDNFIIEPPFYCDYGSNIYIGDNFYANHNLVILDGAKVVIGDNVFIAPNVGIYTAGHPIDVERRLQGLEYAMPVTIGDNVWIGGGVSIIPGVNIGKNSVIAAGSVVIRDIPENVVAAGNPCKVIRKITEKDSTTTNYRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	LHEYNTLSPADENKK EEECCCCCCCCCCHH	18.92	21440633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YJV8_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YJV8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YJV8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YJV8_YEAST	YJL218W	physical	11283351
GAL3_YEAST	GAL3	genetic	27708008
PEX7_YEAST	PEX7	genetic	27708008
HPRT_YEAST	HPT1	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
SNF5_YEAST	SNF5	genetic	27708008
BPT1_YEAST	BPT1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.