UniProt ID | GLRX1_YEAST | |
---|---|---|
UniProt AC | P25373 | |
Protein Name | Glutaredoxin-1 | |
Gene Name | GRX1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 110 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Component of the glutathione system which performs several activities such as glutathione-dependent oxidoreductase, glutathione peroxidase and glutathione S-transferase (GST) activity. The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. In addition, it is also involved in reducing cytosolic protein- and non-protein-disulfides in a coupled system with glutathione reductase. Required for resistance to reactive oxygen species (ROS) by directly reducing hydroperoxides and for the detoxification of ROS-mediated damage. GRX1 is less active as an oxidoreductase than GRX2.. | |
Protein Sequence | MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MVSQETIKHV -----CCCHHHHHHH | 22.47 | 30377154 | |
8 | Ubiquitination | MVSQETIKHVKDLIA CCCHHHHHHHHHHHH | 50.17 | 22817900 | |
8 | 2-Hydroxyisobutyrylation | MVSQETIKHVKDLIA CCCHHHHHHHHHHHH | 50.17 | - | |
11 | Ubiquitination | QETIKHVKDLIAENE HHHHHHHHHHHHHCC | 46.68 | 22817900 | |
11 | Acetylation | QETIKHVKDLIAENE HHHHHHHHHHHHHCC | 46.68 | 22865919 | |
11 | 2-Hydroxyisobutyrylation | QETIKHVKDLIAENE HHHHHHHHHHHHHCC | 46.68 | - | |
27 | Glutathionylation | FVASKTYCPYCHAAL EEEECCCHHHHHHHH | 2.04 | 17327665 | |
40 | Acetylation | ALNTLFEKLKVPRSK HHHHHHHHCCCCHHH | 46.39 | 24489116 | |
42 | 2-Hydroxyisobutyrylation | NTLFEKLKVPRSKVL HHHHHHCCCCHHHEE | 62.35 | - | |
83 | Acetylation | PNIYINGKHIGGNDD CEEEECCEEECCCCC | 27.79 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLRX2_YEAST | GRX2 | genetic | 10844700 | |
URE2_YEAST | URE2 | genetic | 19321443 | |
PRX1_YEAST | PRX1 | genetic | 20059400 | |
GLRX2_YEAST | GRX2 | genetic | 20522499 | |
GLRX7_YEAST | GRX7 | genetic | 20522499 | |
GLRX6_YEAST | GRX6 | genetic | 20522499 | |
JEN1_YEAST | JEN1 | genetic | 21623372 | |
ATP14_YEAST | ATP14 | genetic | 21623372 | |
GLRX2_YEAST | GRX2 | genetic | 25392302 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
VPS41_YEAST | VPS41 | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
UBP3_YEAST | UBP3 | genetic | 27708008 | |
RAD4_YEAST | RAD4 | genetic | 27708008 | |
VAM7_YEAST | VAM7 | genetic | 27708008 | |
PDR11_YEAST | PDR11 | genetic | 27708008 | |
FEN1_YEAST | RAD27 | genetic | 27708008 | |
SAC1_YEAST | SAC1 | genetic | 27708008 | |
ENV10_YEAST | ENV10 | genetic | 27708008 | |
KIN4_YEAST | KIN4 | genetic | 27708008 | |
PUS7_YEAST | PUS7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...