dbPTM

GLRX6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GLRX6_YEAST
UniProt AC	Q12438
Protein Name	Monothiol glutaredoxin-6
Gene Name	GRX6
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	231
Subcellular Localization	Vacuole .
Protein Description
Protein Sequence	MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
102	Acetylation	DDSLSAIKNDKGSRI HHHHHHHHCCCCCCE	59.83	24489116
178	Phosphorylation	QEYIKLVTGRGTVPN HHHHHHHHCCCCCCC	31.43	19684113

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GLRX6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GLRX6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GLRX6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EMP47_YEAST	EMP47	physical	18400945
AP2M_YEAST	APM4	physical	18400945
GLRX6_YEAST	GRX6	physical	18171082
GLRX6_YEAST	GRX6	physical	20347849
GLRX6_YEAST	GRX6	physical	27710937
YAJ9_YEAST	YAR029W	genetic	27708008
YEL1_YEAST	YEL1	genetic	27708008
YPQ3_YEAST	RTC2	genetic	27708008
IES5_YEAST	IES5	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
YG3O_YEAST	YGR153W	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
RRP6_YEAST	RRP6	genetic	27708008
NAA30_YEAST	MAK3	genetic	27708008
CRZ1_YEAST	CRZ1	genetic	25355945
ATC1_YEAST	PMR1	genetic	25355945
CCH1_YEAST	CCH1	genetic	25355945
ATC6_YEAST	SPF1	genetic	25355945
PHO84_YEAST	PHO84	genetic	25355945
PHO89_YEAST	PHO89	genetic	25355945

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GLRX6_YEAST

Related Literatures of Post-Translational Modification