| UniProt ID | GLRX7_YEAST | |
|---|---|---|
| UniProt AC | P38068 | |
| Protein Name | Monothiol glutaredoxin-7 | |
| Gene Name | GRX7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 203 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTVKANSQSESA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 148 | Acetylation | ELQDQIEKVTGRRTV HHHHHHHHHHCCCCC | 46.88 | 24489116 | |
| 176 | Acetylation | TEIAELHKNDELLDS HHHHHHHCCCHHHHH | 77.91 | 24489116 | |
| 185 | Acetylation | DELLDSFKKWSDGAF CHHHHHHHHHCCCCE | 58.23 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GLRX6_YEAST | GRX6 | genetic | 18400945 | |
| GLRX7_YEAST | GRX7 | physical | 18171082 | |
| VAM6_YEAST | VAM6 | genetic | 27708008 | |
| AIM18_YEAST | AIM18 | genetic | 27708008 | |
| YCQ6_YEAST | YCR016W | genetic | 27708008 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| ATG15_YEAST | ATG15 | genetic | 27708008 | |
| PP2C1_YEAST | PTC1 | genetic | 27708008 | |
| GET3_YEAST | GET3 | genetic | 27708008 | |
| S2538_YEAST | YDL119C | genetic | 27708008 | |
| AIM11_YEAST | AIM11 | genetic | 27708008 | |
| NCA3_YEAST | NCA3 | genetic | 27708008 | |
| NOP12_YEAST | NOP12 | genetic | 27708008 | |
| KPYK2_YEAST | PYK2 | genetic | 27708008 | |
| HAT1_YEAST | HAT1 | genetic | 27708008 | |
| YP109_YEAST | YPL109C | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...