UniProt ID | GLRX7_YEAST | |
---|---|---|
UniProt AC | P38068 | |
Protein Name | Monothiol glutaredoxin-7 | |
Gene Name | GRX7 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 203 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTVKANSQSESA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
148 | Acetylation | ELQDQIEKVTGRRTV HHHHHHHHHHCCCCC | 46.88 | 24489116 | |
176 | Acetylation | TEIAELHKNDELLDS HHHHHHHCCCHHHHH | 77.91 | 24489116 | |
185 | Acetylation | DELLDSFKKWSDGAF CHHHHHHHHHCCCCE | 58.23 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLRX6_YEAST | GRX6 | genetic | 18400945 | |
GLRX7_YEAST | GRX7 | physical | 18171082 | |
VAM6_YEAST | VAM6 | genetic | 27708008 | |
AIM18_YEAST | AIM18 | genetic | 27708008 | |
YCQ6_YEAST | YCR016W | genetic | 27708008 | |
BUD31_YEAST | BUD31 | genetic | 27708008 | |
ATG15_YEAST | ATG15 | genetic | 27708008 | |
PP2C1_YEAST | PTC1 | genetic | 27708008 | |
GET3_YEAST | GET3 | genetic | 27708008 | |
S2538_YEAST | YDL119C | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
NCA3_YEAST | NCA3 | genetic | 27708008 | |
NOP12_YEAST | NOP12 | genetic | 27708008 | |
KPYK2_YEAST | PYK2 | genetic | 27708008 | |
HAT1_YEAST | HAT1 | genetic | 27708008 | |
YP109_YEAST | YPL109C | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...