| UniProt ID | TMA16_YEAST | |
|---|---|---|
| UniProt AC | Q08687 | |
| Protein Name | Translation machinery-associated protein 16 | |
| Gene Name | TMA16 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 178 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MPVTKSLSKLQKNLSKKGKNITVHPKGRKYEKLVRATMREDKIAAKKKLHQDKRVHELARVKFMQDVVNSDTFKGQPIFDHAHTREFIQSFIERDDTELDELKKKRRSNRPPSNRQVLLQQRRDQELKEFKAGFLCPDLSDAKNMEFLRNWNGTFGLLNTLRLIRINDKGEQVVGGNE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Acetylation | PVTKSLSKLQKNLSK CCHHHHHHHHHHHHH | 61.30 | 25381059 | |
| 12 | Acetylation | KSLSKLQKNLSKKGK HHHHHHHHHHHHCCC | 71.00 | 25381059 | |
| 15 | Phosphorylation | SKLQKNLSKKGKNIT HHHHHHHHHCCCCEE | 41.54 | 24909858 | |
| 29 | Acetylation | TVHPKGRKYEKLVRA EECCCCHHHHHHHHH | 67.44 | 25381059 | |
| 32 | Acetylation | PKGRKYEKLVRATMR CCCHHHHHHHHHHHH | 49.55 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMA16_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMA16_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMA16_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYFM_YEAST | MSF1 | physical | 16554755 | |
| EBP2_YEAST | EBP2 | physical | 25877921 | |
| NOP4_YEAST | NOP4 | physical | 25877921 | |
| LOC1_YEAST | LOC1 | physical | 25877921 | |
| CDC10_YEAST | CDC10 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| MCE1_YEAST | CEG1 | genetic | 27708008 | |
| SDA1_YEAST | SDA1 | genetic | 27708008 | |
| IPI1_YEAST | IPI1 | genetic | 27708008 | |
| ESS1_YEAST | ESS1 | genetic | 27708008 | |
| PRS7_YEAST | RPT1 | genetic | 27708008 | |
| POB3_YEAST | POB3 | genetic | 27708008 | |
| NAB3_YEAST | NAB3 | genetic | 27708008 | |
| PP2C3_YEAST | PTC3 | genetic | 27708008 | |
| YD514_YEAST | YDR514C | genetic | 27708008 | |
| AIM11_YEAST | AIM11 | genetic | 27708008 | |
| RL29_YEAST | RPL29 | genetic | 27708008 | |
| HAT1_YEAST | HAT1 | genetic | 27708008 | |
| NOP4_YEAST | NOP4 | physical | 27077951 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...