| UniProt ID | NACB2_YEAST | |
|---|---|---|
| UniProt AC | P40314 | |
| Protein Name | Nascent polypeptide-associated complex subunit beta-2 | |
| Gene Name | BTT1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 149 | |
| Subcellular Localization | Cytoplasm. Nucleus. Predominantly cytoplasmic, may also transiently localize to the nucleus.. | |
| Protein Description | Acts as component of the nascent polypeptide-associated complex (NAC), which promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane. Also blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. BTT1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.. | |
| Protein Sequence | MPVDQEKLAKLHKLSAANKVGGTRRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVAEANFFKKNGKVLHFNSAVVQIAPQCNLTMIHGQPKENTLNGLYPSVASQLGSQELEYLTGLAHNLENEQTVLDQLGDRCSETKQQVMNS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Acetylation | -MPVDQEKLAKLHKL -CCCCHHHHHHHHHH | 48.38 | 25381059 | |
| 10 | Acetylation | VDQEKLAKLHKLSAA CCHHHHHHHHHHHHH | 62.65 | 25381059 | |
| 13 | Acetylation | EKLAKLHKLSAANKV HHHHHHHHHHHHHCC | 55.35 | 25381059 | |
| 143 | Ubiquitination | GDRCSETKQQVMNS- HHHHHHHHHHHHCC- | 34.38 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NACB2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NACB2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NACB2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
