| UniProt ID | VEL1_YEAST | |
|---|---|---|
| UniProt AC | P53058 | |
| Protein Name | Protein VEL1 | |
| Gene Name | VEL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 206 | |
| Subcellular Localization | Cytoplasm, cytosol. Intracellular soluble fraction.. | |
| Protein Description | ||
| Protein Sequence | MSFLSIFTFFSVLISVATTVRFDLTNVTCKGLHGPHCGTYVMEVVGQNGTFLGQSTFVGADVLTESAGDAWARYLGQETRFLPKLTTIASNETKNFSPLIFTTNINTCNPQSIGDAMVPFANTVTGEIEYNSWADTADNASFITGLANQLFNSTDYGVQVASCYPNFASVILSTPAVNIFGKDDTLPDYCTAIQLKAVCPPEAGFD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | N-linked_Glycosylation | TVRFDLTNVTCKGLH HHCCCCCCCEECCCC | 34.10 | - | |
| 48 | N-linked_Glycosylation | VMEVVGQNGTFLGQS EEEEECCCCCCCCCC | 45.61 | - | |
| 86 | Phosphorylation | TRFLPKLTTIASNET CCCCCCEEEECCCCC | 23.45 | 28889911 | |
| 91 | N-linked_Glycosylation | KLTTIASNETKNFSP CEEEECCCCCCCCCC | 52.51 | - | |
| 139 | N-linked_Glycosylation | SWADTADNASFITGL CCCCCCCHHHHHHHH | 34.71 | - | |
| 152 | N-linked_Glycosylation | GLANQLFNSTDYGVQ HHHHHHHCCCCCCCE | 53.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VEL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VEL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VEL1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| POP7_YEAST | POP7 | genetic | 27708008 | |
| MCM7_YEAST | MCM7 | genetic | 27708008 | |
| GNA1_YEAST | GNA1 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| TAF1_YEAST | TAF1 | genetic | 27708008 | |
| LCB1_YEAST | LCB1 | genetic | 27708008 | |
| RPA1_YEAST | RPA190 | genetic | 27708008 | |
| IF6_YEAST | TIF6 | genetic | 27708008 | |
| BUR1_YEAST | SGV1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
