UniProt ID | YET2_YEAST | |
---|---|---|
UniProt AC | Q04210 | |
Protein Name | Endoplasmic reticulum transmembrane protein 2 | |
Gene Name | YET2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 160 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi.. | |
Protein Sequence | MGVYLAVLFSLLVIEMAILFILVLPLPQRMRRWLYIRYSIISTNKKFRTYMVGIMIFVGLLFIDSWKRSQIRVSTYRNQKNPYIINSVTPVDALASRAYNQRNVYISGFIIYFYICILTVMSILRRIVEWNDKMKAGDDILKEKLRRKQKYLEELQKKKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YET2_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YET2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YET2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YET2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STE50_YEAST | STE50 | genetic | 20093466 | |
RHEB_YEAST | RHB1 | genetic | 20093466 | |
PCP1_YEAST | PCP1 | genetic | 20093466 | |
PHB2_YEAST | PHB2 | genetic | 20093466 | |
MDM35_YEAST | MDM35 | genetic | 20093466 | |
VRP1_YEAST | VRP1 | genetic | 20093466 | |
YM8M_YEAST | YMR279C | genetic | 20093466 | |
COQ7_YEAST | CAT5 | genetic | 20093466 | |
LIPA_YEAST | LIP5 | genetic | 20093466 | |
CTI6_YEAST | CTI6 | genetic | 20093466 | |
YOP1_YEAST | YOP1 | genetic | 20093466 | |
BRR1_YEAST | BRR1 | genetic | 20093466 | |
SWC5_YEAST | SWC5 | genetic | 21987634 | |
UBX2_YEAST | UBX2 | genetic | 21987634 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
RIM1_YEAST | RIM1 | genetic | 27708008 | |
RAD9_YEAST | RAD9 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
CBP4_YEAST | CBP4 | genetic | 27708008 | |
PHB2_YEAST | PHB2 | genetic | 27708008 | |
FLX1_YEAST | FLX1 | genetic | 27708008 | |
CSN12_YEAST | YJR084W | genetic | 27708008 | |
MDM35_YEAST | MDM35 | genetic | 27708008 | |
COX12_YEAST | COX12 | genetic | 27708008 | |
TOP3_YEAST | TOP3 | genetic | 27708008 | |
YM8M_YEAST | YMR279C | genetic | 27708008 | |
CY1_YEAST | CYT1 | genetic | 27708008 | |
COQ7_YEAST | CAT5 | genetic | 27708008 | |
CTI6_YEAST | CTI6 | genetic | 27708008 | |
BRR1_YEAST | BRR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...