dbPTM

RHEB_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RHEB_YEAST
UniProt AC	P25378
Protein Name	Rheb-like protein RHB1
Gene Name	RHB1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	209
Subcellular Localization	Cell membrane Peripheral membrane protein . Cell periphery, adjacent to the plasma membrane.
Protein Description	Involved in the regulation of arginine and lysine uptake. Acts through the CAN1 permease..
Protein Sequence	MEYATMSSSNSTHNFQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTKADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGLDAENNNKCSIM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEYATMSS -------CCCCCCCC	8.84	22814378
65	Phosphorylation	PYKSHDCTLEILDTA CCCCCCCEEEEECCC	33.22	24909858
78	Phosphorylation	TAGQDEVSLLNIKSL CCCCCCEEEEEHHHH	25.70	24909858
206	Methylation	DAENNNKCSIM---- CCCCCCCCCCC----	3.47	-
206	Farnesylation	DAENNNKCSIM---- CCCCCCCCCCC----	3.47	10753927
206	Farnesylation	DAENNNKCSIM---- CCCCCCCCCCC----	3.47	10753927

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RHEB_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RHEB_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RHEB_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATG34_YEAST	ATG34	physical	10688190
ATG34_YEAST	ATG34	physical	18719252
DCC1_YEAST	DCC1	genetic	19269370
BUB1_YEAST	BUB1	genetic	19269370
STE50_YEAST	STE50	physical	18621925
GPB2_YEAST	GPB2	genetic	20093466
RS8A_YEAST	RPS8A	genetic	20093466
RS8B_YEAST	RPS8A	genetic	20093466
YPQ3_YEAST	RTC2	genetic	20093466
DIT1_YEAST	DIT1	genetic	20093466
CAJ1_YEAST	CAJ1	genetic	20093466
FCY2_YEAST	FCY2	genetic	20093466
OST5_YEAST	OST5	genetic	20093466
ARO8_YEAST	ARO8	genetic	20093466
HSV2_YEAST	HSV2	genetic	20093466
NSG1_YEAST	NSG1	genetic	20093466
ICE2_YEAST	ICE2	genetic	20093466
OSM1_YEAST	OSM1	genetic	20093466
IME1_YEAST	IME1	genetic	20093466
YJ68_YEAST	YJR098C	genetic	20093466
EF1G2_YEAST	TEF4	genetic	20093466
IXR1_YEAST	IXR1	genetic	20093466
BAS1_YEAST	BAS1	genetic	20093466
THI73_YEAST	THI73	genetic	20093466
YL173_YEAST	YLR173W	genetic	20093466
RS25B_YEAST	RPS25B	genetic	20093466
VIP1_YEAST	VIP1	genetic	20093466
YL456_YEAST	YLR456W	genetic	20093466
RSF1_YEAST	RSF1	genetic	20093466
IMP2_YEAST	IMP2	genetic	20093466
YET2_YEAST	YET2	genetic	20093466
AIM36_YEAST	AIM36	genetic	20093466
ERG2_YEAST	ERG2	genetic	20093466
RAS2_YEAST	RAS2	genetic	20093466
HDA1_YEAST	HDA1	genetic	20093466
MSO1_YEAST	MSO1	genetic	20093466
HMI1_YEAST	HMI1	genetic	20093466
MDM12_YEAST	MDM12	genetic	20093466
ALG6_YEAST	ALG6	genetic	20093466
COQ7_YEAST	CAT5	genetic	20093466
SWT1_YEAST	SWT1	genetic	20093466
HUA2_YEAST	HUA2	genetic	20093466

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RHEB_YEAST

Related Literatures of Post-Translational Modification

Prenylation
Reference	PubMed
"The Saccharomyces cerevisiae Rheb G-protein is involved in regulatingcanavanine resistance and arginine uptake."; Urano J., Tabancay A.P., Yang W., Tamanoi F.; J. Biol. Chem. 275:11198-11206(2000). Cited for: CHARACTERIZATION, ISOPRENYLATION AT CYS-206, AND MUTAGENESIS.	10753927 [Abstract]