| UniProt ID | HUG1_YEAST | |
|---|---|---|
| UniProt AC | Q6Q5K6 | |
| Protein Name | MEC1-mediated checkpoint protein HUG1 | |
| Gene Name | HUG1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 68 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Involved in the MEC1-mediated checkpoint response to DNA damage and replication arrest.. | |
| Protein Sequence | MTMDQGLNPKQFFLDDVVLQDTLCSMSNRVNKSVKTGYLFPKDHVPSANIIAVERRGGLSDIGKNTSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | Phosphorylation | VERRGGLSDIGKNTS EEECCCCCCCCCCCC | 30.38 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HUG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HUG1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HUG1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PGM2_YEAST | PGM2 | physical | 18467557 | |
| SLA2_YEAST | SLA2 | physical | 18467557 | |
| SKI3_YEAST | SKI3 | physical | 18467557 | |
| ALO_YEAST | ALO1 | physical | 18467557 | |
| PUR92_YEAST | ADE17 | physical | 18467557 | |
| PGM2_YEAST | PGM2 | physical | 22615397 | |
| RIR2_YEAST | RNR2 | physical | 25378334 | |
| DNA2_YEAST | DNA2 | physical | 25378334 | |
| RIR4_YEAST | RNR4 | physical | 25378334 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| PDC2_YEAST | PDC2 | genetic | 27708008 | |
| GNA1_YEAST | GNA1 | genetic | 27708008 | |
| FDFT_YEAST | ERG9 | genetic | 27708008 | |
| YJ9I_YEAST | YJR141W | genetic | 27708008 | |
| RU1C_YEAST | YHC1 | genetic | 27708008 | |
| SC61A_YEAST | SEC61 | genetic | 27708008 | |
| SMP3_YEAST | SMP3 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 | |
| HRR25_YEAST | HRR25 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
