| UniProt ID | SDO1_YEAST | |
|---|---|---|
| UniProt AC | Q07953 | |
| Protein Name | Ribosome maturation protein SDO1 | |
| Gene Name | SDO1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 250 | |
| Subcellular Localization | Cytoplasm . Nucleus. | |
| Protein Description | Involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with the EF-2-like GTPase RIA1, may trigger the GTP-dependent release of TIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating TIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export.. | |
| Protein Sequence | MPINQPSGQIKLTNVSLVRLKKARKRFEVACYQNKVQDYRKGIEKDLDEVLQIHQVFMNVSKGLVANKEDLQKCFGTTNVDDVIEEIMHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHKALQELKFSPVINKPAKLQALEAIKLLVSKQIIPIVRAKMKVKVAISEPSRQPELIEKISKLIASSPGESTKPELDPWTCTGLIDPVNYRDLMTLCDKKGTVQVLDMAVIDNTTHN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 141 | Acetylation | HKALQELKFSPVINK HHHHHHCCCCCCCCC | 42.94 | 24489116 | |
| 151 | Acetylation | PVINKPAKLQALEAI CCCCCCHHHHHHHHH | 50.05 | 24489116 | |
| 159 | Acetylation | LQALEAIKLLVSKQI HHHHHHHHHHHHCCH | 42.70 | 24489116 | |
| 192 | Acetylation | RQPELIEKISKLIAS CCHHHHHHHHHHHHC | 45.33 | 24489116 | |
| 194 | Phosphorylation | PELIEKISKLIASSP HHHHHHHHHHHHCCC | 32.26 | 19823750 | |
| 199 | Phosphorylation | KISKLIASSPGESTK HHHHHHHCCCCCCCC | 30.03 | 19823750 | |
| 200 | Phosphorylation | ISKLIASSPGESTKP HHHHHHCCCCCCCCC | 28.09 | 19823750 | |
| 204 | Phosphorylation | IASSPGESTKPELDP HHCCCCCCCCCCCCC | 47.87 | 19823750 | |
| 205 | Phosphorylation | ASSPGESTKPELDPW HCCCCCCCCCCCCCC | 46.44 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDO1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDO1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDO1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...