dbPTM

RKM5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RKM5_YEAST
UniProt AC	Q12367
Protein Name	Ribosomal lysine N-methyltransferase 5 {ECO:0000303\|PubMed:21460220}
Gene Name	RKM5 {ECO:0000303\|PubMed:21460220}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	367
Subcellular Localization
Protein Description	S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that monomethylates 60S ribosomal protein L1 (RPL1A and RPL1B) at 'Lys-46'..
Protein Sequence	MAFKLWLLDEETIYEHVFERYTQLEGQSGKLAQDLGIQDRRGGVLEITFEPSGLEGGRKKKRVRRRNKASSVEEDQNVAVDSYHVSVGQSISSLRSSRDNGNSTTGYVLWSTTPFFINWLLYSTSAAPFRLGSQVEVTCGSSCEGHKLELPRLVDLTGADRGKRGILELGAGISGILPVILGNFVDTYVSTDQKGILNKLKDNIMENLSQLTRKRCISRSLRLELPTVEPVGDADITAASLPSKSTLHLEVAALDWEKINLQDKKTHSLHPELSLIGETCSSVYVIAMDVIYNEYLIDPFLKTLKQLKHWLQTTYNLQFHVLVGIHLRSQEVTTLFLEKAIIEYDFTVYDIVDQVIQESRFNFYLIT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RKM5_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RKM5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RKM5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RKM5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL1A_YEAST	RPL1B	physical	21460220
RL1B_YEAST	RPL1B	physical	21460220
EDS1_YEAST	EDS1	genetic	27708008
YAJ9_YEAST	YAR029W	genetic	27708008
EF1G2_YEAST	TEF4	genetic	27708008
CTK1_YEAST	CTK1	genetic	27708008
DOM34_YEAST	DOM34	genetic	27708008
RNH2A_YEAST	RNH201	genetic	27708008
APJ1_YEAST	APJ1	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
PMA2_YEAST	PMA2	genetic	27708008
RL36A_YEAST	RPL36A	genetic	29158977

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RKM5_YEAST

Related Literatures of Post-Translational Modification