| UniProt ID | NOP6_YEAST | |
|---|---|---|
| UniProt AC | Q07623 | |
| Protein Name | Nucleolar protein 6 | |
| Gene Name | NOP6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 225 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Predicted to be involved in rRNA processing.. | |
| Protein Sequence | MGSEEDKKLTKKQLKAQQFRKSKEEKDQEKDVKKEQAPEGKRPNSAAGNDGEEPVKKKRKTRRGRGGKGKNGKKGNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGGGGNSQERLEKLKNKNIKLDEERKERLTKMINDGNQKKIAKTTATAAQTSGTDNKPVPAGIHPDRAKLLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Acetylation | EDKKLTKKQLKAQQF HHHHHHHHHHHHHHH | 56.48 | 25381059 | |
| 15 | Acetylation | KLTKKQLKAQQFRKS HHHHHHHHHHHHHHC | 41.47 | 25381059 | |
| 45 | Phosphorylation | PEGKRPNSAAGNDGE CCCCCCCCCCCCCCC | 23.37 | 19823750 | |
| 56 | Acetylation | NDGEEPVKKKRKTRR CCCCCCCHHCCCCCC | 64.39 | 25381059 | |
| 102 | Phosphorylation | QNHFKNSSPDQIRLR HHHHCCCCHHHEEEE | 41.72 | 25752575 | |
| 123 | Acetylation | FLEFDADKDRTGIQR EEEECCCCCCCHHHH | 51.32 | 24489116 | |
| 160 | Phosphorylation | TVGGGGNSQERLEKL EECCCCCHHHHHHHH | 36.37 | 24909858 | |
| 173 | Acetylation | KLKNKNIKLDEERKE HHHHCCCCCCHHHHH | 60.32 | 25381059 | |
| 184 | Acetylation | ERKERLTKMINDGNQ HHHHHHHHHHHCCCH | 42.23 | 22865919 | |
| 192 | Acetylation | MINDGNQKKIAKTTA HHHCCCHHHHHHHHH | 50.58 | 25381059 | |
| 204 | Phosphorylation | TTATAAQTSGTDNKP HHHHHHHCCCCCCCC | 25.13 | 28889911 | |
| 205 | Phosphorylation | TATAAQTSGTDNKPV HHHHHHCCCCCCCCC | 27.84 | 21440633 | |
| 207 | Phosphorylation | TAAQTSGTDNKPVPA HHHHCCCCCCCCCCC | 35.85 | 27017623 | |
| 210 | Acetylation | QTSGTDNKPVPAGIH HCCCCCCCCCCCCCC | 50.64 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP6_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45, AND MASSSPECTROMETRY. | |
