UniProt ID | RRT5_YEAST | |
---|---|---|
UniProt AC | P43607 | |
Protein Name | Regulator of rDNA transcription protein 5 | |
Gene Name | RRT5 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 289 | |
Subcellular Localization | ||
Protein Description | May be involved in the modulation of rDNA transcription.. | |
Protein Sequence | MTEQVNNDTTSDTTTTITTVYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNTLALKAIQDLNGTVFQNQKLFLKLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTVYCHDLPDDITDSEIRELFQLYSPQEIWIYRSKVYRRKCIPFAPHQITAALVTLQSETPIGDICDSVAKTATLRGKSIIVKPAYVSKIQEIKQLVKDNLTNARDPPPAALAEPAPAPAPVEPAEQVQEGQDNAETNDVPPPPASSSDRPTVAAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | SNLPFTASERDLHAF ECCCCCCCHHHHHHH | 30.06 | 27214570 | |
110 | Phosphorylation | HVPYEADSTPDTDVK CCCCCCCCCCCCCCC | 49.22 | 27214570 | |
111 | Phosphorylation | VPYEADSTPDTDVKK CCCCCCCCCCCCCCC | 26.23 | 27214570 | |
114 | Phosphorylation | EADSTPDTDVKKPKE CCCCCCCCCCCCHHH | 43.85 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRT5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRT5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRT5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VRP1_YEAST | VRP1 | genetic | 27708008 | |
ACH1_YEAST | ACH1 | genetic | 27708008 | |
REI1_YEAST | REI1 | genetic | 27708008 | |
ELO2_YEAST | ELO2 | genetic | 27708008 | |
SNA4_YEAST | SNA4 | genetic | 27708008 | |
DXO1_YEAST | DXO1 | genetic | 27708008 | |
LSM6_YEAST | LSM6 | genetic | 27708008 | |
GLRX2_YEAST | GRX2 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
YKE4_YEAST | YKE4 | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
PCD1_YEAST | PCD1 | genetic | 27708008 | |
TSA1_YEAST | TSA1 | genetic | 27708008 | |
CTK3_YEAST | CTK3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...