| UniProt ID | YKE4_YEAST | |
|---|---|---|
| UniProt AC | P40544 | |
| Protein Name | Zinc transporter YKE4 | |
| Gene Name | YKE4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 346 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Zinc transporter whose role depends on the zinc status of the cells. It helps to balance zinc levels between the cytosol and the secretory pathway. It transports zinc into the secretory pathway in a zinc-adequate environment and in a high zinc medium. In high zinc medium, transport of zinc into the secretory pathway is a way to eliminate zinc from the cytosol. Under low cytosolic zinc conditions, it removes zinc from the secretory pathway and acts as zinc importer that helps to alleviate ER stress.. | |
| Protein Sequence | MKASHICSYLLSIAPLVVSHGVHHNRDHGHEANHESKQSFLILKQESIFYSLVCFLQNHLFVLGPRYNAIVAILIIQLMPCLFVLFVPGLRKNDRASLTLSLLVSFSLGTLLGDILLHVIPESLSGVTDVTMVGGAIFLGFISFLTLDKTMRILSGTSNDDGSIHSHSHSHTPQQTAEKKAGFNMSAYLNVISGIAHHITDGIALATSFYSSTQVGIMTSIAVTFHEIPHELGDFAILLSSGFTFPQAIRAQAVTAFGAVVGTSIGCWMNEIGNNSHKATSSSANASELMLPFTAGGLIYIATTSVVPQILHSSAPDSKLREFKKWALQLVFIFVGFAVMALMDEH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 184 | N-linked_Glycosylation | AEKKAGFNMSAYLNV HHHHCCCCHHHHHHH | 23.68 | - | |
| 274 | N-linked_Glycosylation | CWMNEIGNNSHKATS HCHHHCCCCCCCCCC | 53.12 | - | |
| 285 | N-linked_Glycosylation | KATSSSANASELMLP CCCCCCCCHHHHCCE | 46.04 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKE4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKE4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKE4_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZRC1_YEAST | ZRC1 | genetic | 16760462 | |
| PCL1_YEAST | PCL1 | genetic | 16760462 | |
| COT1_YEAST | COT1 | genetic | 16760462 | |
| RL23A_YEAST | RPL23A | genetic | 16760462 | |
| RL23B_YEAST | RPL23A | genetic | 16760462 | |
| MSC2_YEAST | MSC2 | genetic | 16760462 | |
| SLX5_YEAST | SLX5 | genetic | 20093466 | |
| MRT4_YEAST | MRT4 | genetic | 20093466 | |
| CIK1_YEAST | CIK1 | genetic | 20093466 | |
| LSM7_YEAST | LSM7 | genetic | 20093466 | |
| EOS1_YEAST | EOS1 | genetic | 20093466 | |
| DUS2_YEAST | SMM1 | genetic | 20093466 | |
| BUB3_YEAST | BUB3 | genetic | 20093466 | |
| TGS1_YEAST | TGS1 | genetic | 20093466 | |
| SUE1_YEAST | SUE1 | genetic | 20093466 | |
| SLX5_YEAST | SLX5 | genetic | 27708008 | |
| IMG2_YEAST | IMG2 | genetic | 27708008 | |
| MRT4_YEAST | MRT4 | genetic | 27708008 | |
| UBX2_YEAST | UBX2 | genetic | 27708008 | |
| EOS1_YEAST | EOS1 | genetic | 27708008 | |
| LSM7_YEAST | LSM7 | genetic | 27708008 | |
| NCBP2_YEAST | CBC2 | genetic | 27708008 | |
| SUE1_YEAST | SUE1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
