UniProt ID | YK25_YEAST | |
---|---|---|
UniProt AC | P36138 | |
Protein Name | Uncharacterized protein YKR045C | |
Gene Name | YKR045C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 183 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MSNSHHTSQGRRNKLSVWVKKIINTTTTTNASVSSSKPRRGTRAGPTRVKRAELDPDGTTISSSLRPLVDRNSLHSSESDDEGDRRVAWDEPPTGKVRQQQQQQQQQQNDNASVIPLVSFCSSSVKSSTFSDIHSIQSTRPTIFSNRTFETNSSVLAIPPQSILDRSRTLPPSNASNTTTRRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Ubiquitination | KLSVWVKKIINTTTT CHHHHHHHHHCCCCC | 38.92 | 22106047 | |
32 | Phosphorylation | TTTTTNASVSSSKPR CCCCCCCCCCCCCCC | 25.30 | 21082442 | |
35 | Phosphorylation | TTNASVSSSKPRRGT CCCCCCCCCCCCCCC | 39.98 | 21082442 | |
37 | Ubiquitination | NASVSSSKPRRGTRA CCCCCCCCCCCCCCC | 44.48 | 23749301 | |
76 | Phosphorylation | VDRNSLHSSESDDEG CCCCCCCCCCCCCCC | 40.88 | 28132839 | |
79 | Phosphorylation | NSLHSSESDDEGDRR CCCCCCCCCCCCCCC | 52.92 | 28889911 | |
124 | Phosphorylation | LVSFCSSSVKSSTFS HHHHHCCCCCCCCHH | 19.78 | 21551504 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YK25_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YK25_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YK25_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
COG3_YEAST | COG3 | genetic | 27708008 | |
STU1_YEAST | STU1 | genetic | 27708008 | |
KPC1_YEAST | PKC1 | genetic | 27708008 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
MAK5_YEAST | MAK5 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
GPI11_YEAST | GPI11 | genetic | 27708008 | |
NCS1_YEAST | FRQ1 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
BIG1_YEAST | BIG1 | genetic | 27708008 | |
RHO3_YEAST | RHO3 | genetic | 27708008 | |
KRE9_YEAST | KRE9 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
SEC39_YEAST | SEC39 | genetic | 27708008 | |
SEC63_YEAST | SEC63 | genetic | 27708008 | |
SEC62_YEAST | SEC62 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...