UniProt ID | YO131_YEAST | |
---|---|---|
UniProt AC | Q08270 | |
Protein Name | Uncharacterized protein YOL131W | |
Gene Name | YOL131W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 108 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIKINDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDEENTVDSQY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | QRAELAHSVWNLRFN HHHHHHHHHHHHHCC | 24.18 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO131_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO131_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO131_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SWI6_YEAST | SWI6 | physical | 11283351 | |
SOK1_YEAST | SOK1 | genetic | 27708008 | |
SFGH_YEAST | YJL068C | genetic | 27708008 | |
PFD4_YEAST | GIM3 | genetic | 27708008 | |
H3_YEAST | HHT1 | genetic | 27708008 | |
RL41A_YEAST | RPL41A | genetic | 27708008 | |
RL41B_YEAST | RPL41A | genetic | 27708008 | |
MGMT_YEAST | MGT1 | genetic | 27708008 | |
YG1O_YEAST | YGR035C | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
SODM_YEAST | SOD2 | genetic | 27708008 | |
MDV1_YEAST | MDV1 | genetic | 27708008 | |
NDUF7_YEAST | YKL162C | genetic | 27708008 | |
SAC1_YEAST | SAC1 | genetic | 27708008 | |
OSH6_YEAST | OSH6 | genetic | 27708008 | |
UTH1_YEAST | UTH1 | genetic | 27708008 | |
SRL3_YEAST | SRL3 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
SRR1L_YEAST | BER1 | genetic | 27708008 | |
YM59_YEAST | YMR209C | genetic | 27708008 | |
APJ1_YEAST | APJ1 | genetic | 27708008 | |
YO223_YEAST | DSC3 | genetic | 27708008 | |
DGK1_YEAST | DGK1 | genetic | 27708008 | |
PDR10_YEAST | PDR10 | genetic | 27708008 | |
RAD1_YEAST | RAD1 | genetic | 27708008 | |
MRX11_YEAST | YPL041C | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...