dbPTM

YM59_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YM59_YEAST
UniProt AC	Q03648
Protein Name	Uncharacterized protein YMR209C
Gene Name	YMR209C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	457
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MVSSLASNIILALVVVLMTLLRQNKPLQRWFVSYVEKLLSRKSNLAQKVSVLSPSLKLVDVEKSISADQSNLSKINYQIPTLPDLTGNLIRLHEYRARGEGYNGLLFRRARQLNGISEDQLQKLGYFTKLMKNNEGIRENARVIDKIIEFTLGKLIHSNEHDEEFTEEIEKICAEHGYKIKDGHLIQLNPDFVFPIVSSRGSQSVVHEALAHLCRDFSSYYSVERDPLQNFIISRINHHVISAGDMKEKILIVTPGAGVGGLSHTLATTFPKIQVDSIELSALMYICNLFALEYKHDVKIRPFVQQYSCQTVFDNQLRSLSADLSKVGHRSNLDPLWGDFTRYSPISKDYDKIIICSAYFIDTAENMFEYLSSIEALKKYCKELHWVNVGPLKYGTKPLVQFTGDELSRLRKIRGWKDLVEEYEVDSSKGLNGYLTDYESMYQGYYGLLKFHSVFES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MVSSLASNII -----CCHHHHHHHH	20.52	19795423
4	Phosphorylation	----MVSSLASNIIL ----CCHHHHHHHHH	19.28	19795423
7	Phosphorylation	-MVSSLASNIILALV -CCHHHHHHHHHHHH	33.58	19795423
19	Phosphorylation	ALVVVLMTLLRQNKP HHHHHHHHHHHCCCH	20.62	19823750
242	Phosphorylation	RINHHVISAGDMKEK HHCCCEECCCCCCCC	25.72	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YM59_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YM59_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YM59_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UME6_YEAST	UME6	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
ELP2_YEAST	ELP2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YM59_YEAST

Related Literatures of Post-Translational Modification