| UniProt ID | RL28_YEAST | |
|---|---|---|
| UniProt AC | P02406 | |
| Protein Name | 60S ribosomal protein L28 {ECO:0000303|PubMed:9559554} | |
| Gene Name | RPL28 {ECO:0000303|PubMed:9559554} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 149 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.. | |
| Protein Sequence | MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | 2-Hydroxyisobutyrylation | RGHVSAGKGRIGKHR CCCCCCCCCCCCCCC | 44.74 | - | |
| 47 | Ubiquitination | HHRINMDKYHPGYFG CCCCCCHHCCCCCCC | 34.39 | 23749301 | |
| 47 | Acetylation | HHRINMDKYHPGYFG CCCCCCHHCCCCCCC | 34.39 | 24489116 | |
| 52 | Phosphorylation | MDKYHPGYFGKVGMR CHHCCCCCCCCCCHH | 17.38 | 23749301 | |
| 55 | Succinylation | YHPGYFGKVGMRYFH CCCCCCCCCCHHHHH | 26.22 | 23954790 | |
| 55 | Acetylation | YHPGYFGKVGMRYFH CCCCCCCCCCHHHHH | 26.22 | 24489116 | |
| 55 | Ubiquitination | YHPGYFGKVGMRYFH CCCCCCCCCCHHHHH | 26.22 | 22817900 | |
| 63 | Acetylation | VGMRYFHKQQAHFWK CCHHHHHHHCCCCCC | 33.92 | 22865919 | |
| 63 | Ubiquitination | VGMRYFHKQQAHFWK CCHHHHHHHCCCCCC | 33.92 | 17644757 | |
| 70 | Ubiquitination | KQQAHFWKPVLNLDK HHCCCCCCCCCCHHH | 25.06 | 23749301 | |
| 70 | Succinylation | KQQAHFWKPVLNLDK HHCCCCCCCCCCHHH | 25.06 | 23954790 | |
| 70 | Acetylation | KQQAHFWKPVLNLDK HHCCCCCCCCCCHHH | 25.06 | 24489116 | |
| 77 | Ubiquitination | KPVLNLDKLWTLIPE CCCCCHHHHHHCCCH | 49.44 | 17644757 | |
| 80 | Phosphorylation | LNLDKLWTLIPEDKR CCHHHHHHCCCHHHH | 25.83 | 21440633 | |
| 86 | Acetylation | WTLIPEDKRDQYLKS HHCCCHHHHHHHHHH | 57.10 | 24489116 | |
| 86 | Ubiquitination | WTLIPEDKRDQYLKS HHCCCHHHHHHHHHH | 57.10 | 23749301 | |
| 86 | 2-Hydroxyisobutyrylation | WTLIPEDKRDQYLKS HHCCCHHHHHHHHHH | 57.10 | - | |
| 92 | Acetylation | DKRDQYLKSASKETA HHHHHHHHHCCCCCH | 38.76 | 24489116 | |
| 92 | 2-Hydroxyisobutyrylation | DKRDQYLKSASKETA HHHHHHHHHCCCCCH | 38.76 | - | |
| 92 | Ubiquitination | DKRDQYLKSASKETA HHHHHHHHHCCCCCH | 38.76 | 23749301 | |
| 93 | Phosphorylation | KRDQYLKSASKETAP HHHHHHHHCCCCCHH | 34.87 | 23749301 | |
| 95 | Phosphorylation | DQYLKSASKETAPVI HHHHHHCCCCCHHHH | 37.81 | 21440633 | |
| 96 | Ubiquitination | QYLKSASKETAPVID HHHHHCCCCCHHHHH | 59.82 | 23749301 | |
| 96 | Succinylation | QYLKSASKETAPVID HHHHHCCCCCHHHHH | 59.82 | 23954790 | |
| 96 | Acetylation | QYLKSASKETAPVID HHHHHCCCCCHHHHH | 59.82 | 24489116 | |
| 98 | Phosphorylation | LKSASKETAPVIDTL HHHCCCCCHHHHHHH | 39.74 | 21440633 | |
| 104 | Phosphorylation | ETAPVIDTLAAGYGK CCHHHHHHHHHCCHH | 13.74 | 23749301 | |
| 111 | Succinylation | TLAAGYGKILGKGRI HHHHCCHHHHCCCCC | 26.69 | 23954790 | |
| 111 | Ubiquitination | TLAAGYGKILGKGRI HHHHCCHHHHCCCCC | 26.69 | 17644757 | |
| 111 | Acetylation | TLAAGYGKILGKGRI HHHHCCHHHHCCCCC | 26.69 | 24489116 | |
| 115 | Ubiquitination | GYGKILGKGRIPNVP CCHHHHCCCCCCCCC | 41.38 | 17644757 | |
| 126 | 2-Hydroxyisobutyrylation | PNVPVIVKARFVSKL CCCCEEEEEHHHHHH | 23.79 | - | |
| 126 | Acetylation | PNVPVIVKARFVSKL CCCCEEEEEHHHHHH | 23.79 | 24489116 | |
| 126 | Ubiquitination | PNVPVIVKARFVSKL CCCCEEEEEHHHHHH | 23.79 | 23749301 | |
| 131 | Phosphorylation | IVKARFVSKLAEEKI EEEEHHHHHHHHHHH | 21.17 | 23749301 | |
| 132 | Ubiquitination | VKARFVSKLAEEKIR EEEHHHHHHHHHHHH | 46.55 | 23749301 | |
| 132 | Succinylation | VKARFVSKLAEEKIR EEEHHHHHHHHHHHH | 46.55 | 23954790 | |
| 132 | Acetylation | VKARFVSKLAEEKIR EEEHHHHHHHHHHHH | 46.55 | 24489116 | |
| 132 | 2-Hydroxyisobutyrylation | VKARFVSKLAEEKIR EEEHHHHHHHHHHHH | 46.55 | - | |
| 137 | Ubiquitination | VSKLAEEKIRAAGGV HHHHHHHHHHHCCCE | 29.06 | 23749301 | |
| 137 | Acetylation | VSKLAEEKIRAAGGV HHHHHHHHHHHCCCE | 29.06 | 24489116 | |
| 137 | 2-Hydroxyisobutyrylation | VSKLAEEKIRAAGGV HHHHHHHHHHHCCCE | 29.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL28_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL28_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL28_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
