UniProt ID | SFC1_YEAST | |
---|---|---|
UniProt AC | P33303 | |
Protein Name | Succinate/fumarate mitochondrial transporter | |
Gene Name | SFC1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 322 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Transports cytoplasmic succinate, derived from isocitrate by the action of isocitrate lyase in the cytosol, into the mitochondrial matrix in exchange for fumarate.. | |
Protein Sequence | MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGIFKKNDTPKPKPLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFC1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFC1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFC1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX22_YEAST | PEX22 | genetic | 20093466 | |
DEP1_YEAST | DEP1 | genetic | 20093466 | |
YSW1_YEAST | YSW1 | genetic | 20093466 | |
AIM4_YEAST | AIM4 | genetic | 20093466 | |
GDIR_YEAST | RDI1 | genetic | 20093466 | |
SNF6_YEAST | SNF6 | genetic | 20093466 | |
PDX3_YEAST | PDX3 | genetic | 21623372 | |
AATC_YEAST | AAT2 | genetic | 21623372 | |
IDH2_YEAST | IDH2 | genetic | 21623372 | |
IDH1_YEAST | IDH1 | genetic | 21623372 | |
SYSM_YEAST | DIA4 | genetic | 21623372 | |
PFKA1_YEAST | PFK1 | genetic | 21623372 | |
QCR2_YEAST | QCR2 | genetic | 21623372 | |
SSB1_YEAST | SSB1 | physical | 22940862 | |
HSP71_YEAST | SSA1 | physical | 22940862 | |
HSP72_YEAST | SSA2 | physical | 22940862 | |
PEX22_YEAST | PEX22 | genetic | 27708008 | |
AIM4_YEAST | AIM4 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
MED5_YEAST | NUT1 | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
IDH2_YEAST | IDH2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...