UniProt ID | DCS2_YEAST | |
---|---|---|
UniProt AC | Q12123 | |
Protein Name | Inactive diphosphatase DCS2 | |
Gene Name | DCS2 {ECO:0000312|SGD:S000005699} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 353 | |
Subcellular Localization | Cytoplasm. Cytoplasm, perinuclear region. Cytoplasm, P-body. Predominantly cytoplasmic. Localizes close to the perinuclear space before the diauxic growth shift. Recruited to the P-body after the post-diauxic growth shift. Colocalizes with the decapp | |
Protein Description | Plays a role in the cleavage of a residual cap structure following the degradation of mRNAs by the 3'->5' exosome-mediated mRNA decay pathway. Stress-induced regulatory protein that modulates the m7GpppX diphosphatase activity of DCS1.. | |
Protein Sequence | MGSQDLASLIGRFKYVRVLDSNPHTKVISLLGSIDGKDAVLTAEKTHFIFDETVRRPSQSGRSTPIFFHREIDEYSFLNGITDLKELTSNDIYYWGLSVLKQHILHNPTAKVNLIWPASQFHIKGYDQQDLHVVRETPDMYRNIVVPFIQEMCTSERMKWVNNILYEGAEDDRVVYKEYSSRNKEDGFVILPDMKWDGINIDSLYLVAIVYRDDIKSLRDLNPNHRDWLIRLNKKIKTIIPQHYDYNVNPDELRVFIHYQPSYYHFHVHIVNIRHPGVGEERGSGMTILLEDVIEALGFLGPEGYMKKTLTYVIGENHDLWKKGFKEEVEKQLKHDGIATSPEKGSGFNTNLG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGSQDLASLI -----CCHHHHHHHH | 21.15 | 28889911 | |
8 | Phosphorylation | MGSQDLASLIGRFKY CCHHHHHHHHHHCEE | 28.02 | 22369663 | |
21 | Phosphorylation | KYVRVLDSNPHTKVI EEEEEECCCCCCCEE | 48.37 | 22369663 | |
25 | Phosphorylation | VLDSNPHTKVISLLG EECCCCCCCEEEEEE | 28.41 | 22369663 | |
42 | Phosphorylation | DGKDAVLTAEKTHFI CCCCCEEEEECEEEE | 26.60 | 22369663 | |
46 | Phosphorylation | AVLTAEKTHFIFDET CEEEEECEEEEEECC | 17.33 | 22369663 | |
53 | Phosphorylation | THFIFDETVRRPSQS EEEEEECCCCCCCCC | 22.58 | 22369663 | |
58 | Phosphorylation | DETVRRPSQSGRSTP ECCCCCCCCCCCCCC | 34.86 | 22369663 | |
60 | Phosphorylation | TVRRPSQSGRSTPIF CCCCCCCCCCCCCEE | 40.28 | 22369663 | |
63 | Phosphorylation | RPSQSGRSTPIFFHR CCCCCCCCCCEEEEC | 41.90 | 22369663 | |
64 | Phosphorylation | PSQSGRSTPIFFHRE CCCCCCCCCEEEECC | 21.02 | 22369663 | |
75 | Phosphorylation | FHREIDEYSFLNGIT EECCCHHHHCCCCCC | 10.85 | 24961812 | |
166 | Phosphorylation | KWVNNILYEGAEDDR HHHHHHHHCCCCCCC | 14.44 | 19779198 | |
340 | Phosphorylation | LKHDGIATSPEKGSG HCCCCCCCCCCCCCC | 42.78 | 22369663 | |
341 | Phosphorylation | KHDGIATSPEKGSGF CCCCCCCCCCCCCCC | 23.26 | 22369663 | |
346 | Phosphorylation | ATSPEKGSGFNTNLG CCCCCCCCCCCCCCC | 51.81 | 19779198 | |
350 | Phosphorylation | EKGSGFNTNLG---- CCCCCCCCCCC---- | 29.56 | 29136822 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCS2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCS2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCS2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NET1_YEAST | NET1 | physical | 16554755 | |
DCPS_YEAST | DCS1 | physical | 16963086 | |
HSP78_YEAST | HSP78 | genetic | 20093466 | |
RTF1_YEAST | RTF1 | genetic | 20093466 | |
GET1_YEAST | GET1 | genetic | 20093466 | |
ASK10_YEAST | ASK10 | genetic | 20093466 | |
COPE_YEAST | SEC28 | genetic | 20093466 | |
SNX4_YEAST | SNX4 | genetic | 20093466 | |
FEN1_YEAST | RAD27 | genetic | 20093466 | |
BRE2_YEAST | BRE2 | genetic | 20093466 | |
VPS9_YEAST | VPS9 | genetic | 20093466 | |
YPT7_YEAST | YPT7 | genetic | 20093466 | |
YAR1_YEAST | YAR1 | genetic | 20093466 | |
BRE1_YEAST | BRE1 | genetic | 27708008 | |
GET1_YEAST | GET1 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
ICE2_YEAST | ICE2 | genetic | 27708008 | |
SNX4_YEAST | SNX4 | genetic | 27708008 | |
VPS24_YEAST | VPS24 | genetic | 27708008 | |
BRE2_YEAST | BRE2 | genetic | 27708008 | |
VIP1_YEAST | VIP1 | genetic | 27708008 | |
YPT7_YEAST | YPT7 | genetic | 27708008 | |
UBX2_YEAST | UBX2 | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
VPS27_YEAST | VPS27 | genetic | 27708008 | |
PRM3_YEAST | PRM3 | genetic | 27708008 | |
YAR1_YEAST | YAR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3; SER-63; THR-64;THR-340 AND SER-341, AND MASS SPECTROMETRY. | |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-64; THR-340 AND SER-341,AND MASS SPECTROMETRY. |